Burkholderia mallei NCTC 10247: BMA10247_2965 Help Entry BMA10247_2965     CDS       T00479                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bmn  Burkholderia mallei NCTC 10247 Brite KEGG Orthology (KO) [BR:bmn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmn03036]     BMA10247_2965    03400 DNA repair and recombination proteins [BR:bmn03400]     BMA10247_2965 Chromosome and associated proteins [BR:bmn03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BMA10247_2965 DNA repair and recombination proteins [BR:bmn03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BMA10247_2965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Topoisom_I_N Motif Other DBs NCBI-ProteinID:  ABO04126 LinkDB All DBs Position I:2923282..2923575 Genome browser AA seq 97 aa AA seqDB search MSSYKDLLAQREKLEKQIEEAKSREYAEVLSDVKQKIADYGFTLAELGLGRGKAGKAGRP RAGVAAKYRDPESGATWSGRGKPPRWIAGKNREQFAI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggaccttctcgctcagcgagagaagctggagaagcagatcgaagaa gccaagtcgcgcgaatacgcggaggtattgagcgacgtcaagcaaaagatcgccgattac ggtttcacgctcgcggaactcggtctcggtcgtggcaaagctggaaaagcggggcgaccc cgcgctggcgtcgcggcgaaataccgcgatccggaatccggcgcaacctggtcgggccgc gggaagcctcctcgctggatcgccggcaagaatcgcgaacaattcgcgatctga

DBGET integrated database retrieval system