KEGG   Burkholderia mallei NCTC 10247: BMA10247_A0694
Entry
BMA10247_A0694    CDS       T00479                                 
Name
(GenBank) taurine dioxygenase-related protein
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn00430  Taurine and hypotaurine metabolism
bmn00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BMA10247_A0694
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BMA10247_A0694
Enzymes [BR:bmn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     BMA10247_A0694
SSDB
Motif
Pfam: TauD TPR_2
Other DBs
NCBI-ProteinID: ABO02644
LinkDB
Position
II:complement(647096..647407)
AA seq 103 aa
MIAFNPSVAHPVVRTHPETGRKTLFVNEGFTTEIDELPEEEGAALLRFLFAHQSRPEFTL
RWRWQPGDVAFWDNRSTIHYAVNDYGKAHRVMHRATIVGDRPY
NT seq 312 nt   +upstreamnt  +downstreamnt
gtgatcgcgttcaatccgagcgtcgcgcatcccgtcgtgcgcacgcacccggagaccggc
cgcaagacgctgttcgtcaacgaaggcttcacgaccgagatcgacgagctgcccgaagag
gaaggcgccgcgctgctgcgcttcctgttcgcgcatcagtcgcggcccgagttcacgctg
cgctggcgctggcagccgggcgacgtcgcgttctgggacaaccgctcgacgatccattac
gcggtgaacgactacggcaaagcgcatcgggtgatgcaccgcgcgacgatcgtcggcgac
aggccgtattga

DBGET integrated database retrieval system