KEGG   Bacillus mojavensis: HC660_11870
Entry
HC660_11870       CDS       T07122                                 
Symbol
med
Name
(GenBank) Positive regulator of comK
  KO
K05519  transcriptional activator of comK gene
Organism
bmoj  Bacillus mojavensis
Brite
KEGG Orthology (KO) [BR:bmoj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bmoj03000]
    HC660_11870 (med)
Transcription factors [BR:bmoj03000]
 Prokaryotic type
  Other transcription factors
   Others
    HC660_11870 (med)
SSDB
Motif
Pfam: Bmp LPAM_2
Other DBs
NCBI-ProteinID: QJC95664
UniProt: A0A6H2JP90
LinkDB
Position
1210407..1211360
AA seq 317 aa
MITRLVMIFSVLLLLSGCGQTPFKGKIEKVGMLFPDTINDLVWGTKGYKGLLNIQSKYNV
DVYYKEGVKTDEDIINAIEDFHKRGVNLLFGHGSEFEEVFNLVSEDYPDMQFVISNAKAK
ADNVTSVHLSGEAIGFFGGMTAAHMSKTNQVGVIASFTWQPEVDGFIKGAKYEDPNIEVN
TKYTDHWDDDSTAVNLYQKMKNEGADVVYPAGDGYNVPVIQQIKKDGLYAIGYVTDQSDL
GENTVLTSTVQNVDKAYEIIAEQFDKGTLKGGDHYYDLKSRVVEMGTFSPLVDKDFQKKI
AKLVKMYNKTGELPKNE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgatcacaaggcttgtcatgatcttttctgtcctccttttattaagcggatgtggacaa
actccgtttaaaggaaaaattgagaaggtcggcatgctctttcctgatacgattaatgac
ctcgtatggggcacaaaagggtataaaggattattgaatatacagtctaaatacaatgtg
gacgtctactataaagaaggcgtaaaaacagatgaagatattataaatgcgattgaagat
tttcataagcgcggcgtcaatctcctctttggccatggaagtgagtttgaagaagtattt
aacttggtcagtgaagactatccggatatgcagtttgtgatttcaaatgcaaaagcaaaa
gcggacaatgtcacaagcgtccatctcagcggggaagcaatcggctttttcggcggaatg
actgctgcccatatgtcaaaaaccaatcaggtcggtgttatcgcttcttttacatggcag
ccagaagttgacggctttataaaaggggctaagtatgaagatcctaatatagaagtgaat
acaaaatatacggatcactgggatgatgattcgactgcggttaacctttatcaaaaaatg
aagaatgaaggcgcagatgttgtgtatcctgccggagatgggtataatgttcctgtcatt
cagcaaatcaaaaaagacggcctatatgcgatcggctatgtcacagatcaatccgatctt
ggcgagaacaccgtgttaaccagcacggtgcaaaatgtggacaaggcctatgaaatcata
gctgagcaattcgacaaaggcactttaaaaggcggcgatcactattacgatctgaaaagc
cgagttgtcgaaatgggaaccttcagtccgcttgtggacaaagactttcagaaaaaaatc
gccaaactggtcaaaatgtataacaaaacaggtgaactgccaaaaaacgagtaa

DBGET integrated database retrieval system