Bombyx mori (domestic silkworm): 100146110 Help Entry 100146110         CDS       T02817                                  Symbol Bbx-f1 Name (RefSeq) bombyxin F-1 precursor   KO K04526   insulin Organism bmor  Bombyx mori (domestic silkworm) Pathway bmor04068   FoxO signaling pathway bmor04081   Hormone signaling bmor04140   Autophagy - animal bmor04150   mTOR signaling pathway bmor04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:bmor00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     100146110 (Bbx-f1)    04150 mTOR signaling pathway     100146110 (Bbx-f1)   09133 Signaling molecules and interaction    04081 Hormone signaling     100146110 (Bbx-f1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100146110 (Bbx-f1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     100146110 (Bbx-f1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bmor04052]     100146110 (Bbx-f1) Cytokines and neuropeptides [BR:bmor04052]  Neuropeptides   Unclassified    100146110 (Bbx-f1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Ibs_toxin Motif Other DBs NCBI-GeneID:  100146110 NCBI-ProteinID:  NP_001119734 UniProt:  P91896 LinkDB All DBs Position 11:6503536..6503823 Genome browser AA seq 95 aa AA seqDB search MKLVVIVLLVISVSILVSAQELGGSRRYCGRHLAQTMAVLCWGIDEMSAEKRNSDMVYED SGMPELLPADTRKKRGIIDECCLQACTRDVLLSYC NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaagttggttgttatcgtcctgttggtgatttccgtcagcattttggtgtcagcgcaa gagttaggaggctctcgtagatattgtggacgacacctagctcagactatggcagtgctc tgctggggcatagatgaaatgtcagccgagaaacgtaatagtgatatggtttatgaagac tccggcatgcccgaacttctcccggctgatactcgtaaaaagcgaggcatcatcgacgaa tgttgtctccaagcctgcacccgggacgtccttctgtcttactgctag

DBGET integrated database retrieval system