Bombyx mori (domestic silkworm): 100169657 Help Entry 100169657         CDS       T02817                                  Symbol Bbx-a4 Name (RefSeq) bombyxin A-4 precursor   KO K04526   insulin Organism bmor  Bombyx mori (domestic silkworm) Pathway bmor04068   FoxO signaling pathway bmor04081   Hormone signaling bmor04140   Autophagy - animal bmor04150   mTOR signaling pathway bmor04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:bmor00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     100169657 (Bbx-a4)    04150 mTOR signaling pathway     100169657 (Bbx-a4)   09133 Signaling molecules and interaction    04081 Hormone signaling     100169657 (Bbx-a4)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100169657 (Bbx-a4)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     100169657 (Bbx-a4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bmor04052]     100169657 (Bbx-a4) Cytokines and neuropeptides [BR:bmor04052]  Neuropeptides   Unclassified    100169657 (Bbx-a4) SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  100169657 NCBI-ProteinID:  NP_001121607 UniProt:  P26727 A0A8R1TC79 LinkDB All DBs Position 11 Genome browser AA seq 92 aa AA seqDB search MKILLAIALILSTVMWVSTQQPQGVHTYCGRHLARTLADLCWEAGVDKRSGAQFASYGSA WLMPYSEGRGKRGIVDECCLRPCSVDVLLSYC NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagattctccttgctattgcattaatattgtcaacagtaatgtgggtgtcaacacaa cagccacaaggagtgcacacgtactgcgggcgccacttggctcgcactctggccgacctg tgctgggaagcgggcgtggacaagcgcagcggtgctcagttcgcgagctacggctccgcg tggctgatgccgtactcggaaggacgcggcaaacgaggcatcgtggatgagtgctgtctc agaccctgcagcgtggacgtgcttctgtcgtactgttag

DBGET integrated database retrieval system