Bombyx mori (domestic silkworm): 100169718 Help Entry 100169718         CDS       T02817                                  Symbol Bbx-b8 Name (RefSeq) bombyxin B-8 precursor   KO K05459   insulin-like growth factor 1 Organism bmor  Bombyx mori (domestic silkworm) Pathway bmor04068   FoxO signaling pathway bmor04081   Hormone signaling bmor04150   mTOR signaling pathway bmor04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:bmor00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     100169718 (Bbx-b8)    04150 mTOR signaling pathway     100169718 (Bbx-b8)   09133 Signaling molecules and interaction    04081 Hormone signaling     100169718 (Bbx-b8)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     100169718 (Bbx-b8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bmor04052]     100169718 (Bbx-b8) Cytokines and neuropeptides [BR:bmor04052]  Cytokines   Growth factors (RTK binding)    100169718 (Bbx-b8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  100169718 NCBI-ProteinID:  NP_001121790 UniProt:  P26742 LinkDB All DBs Position 11:complement(6491844..6492245) Genome browser AA seq 88 aa AA seqDB search MKTSVIFVLIVLNLMWSGEAQEVARTYCGSHLADTLADLCFGVVKRGGAQYAPYFWQKAY LGSRGKRGVVDECCFRPCTLDVLASYCG NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaagacttcagtaatttttgtattaatcgtgctcaacctgatgtggtcaggtgaggcc caggaggtagcgcgtacgtattgcggatctcacttggcggatacactcgccgacttgtgc ttcggagtggtgaaacgcggtggtgctcagtacgcgccctacttctggcagaaagcatac ttgggatctcgcgggaaacgcggcgtagtggacgaatgctgtttccggccttgcacactt gacgttctcgcatcgtactgcggatag

DBGET integrated database retrieval system