Bombyx mori (domestic silkworm): 101736783 Help Entry 101736783         CDS       T02817                                  Name (RefSeq) bombyxin A-1-like   KO K04526   insulin Organism bmor  Bombyx mori (domestic silkworm) Pathway bmor04068   FoxO signaling pathway bmor04081   Hormone signaling bmor04140   Autophagy - animal bmor04150   mTOR signaling pathway bmor04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:bmor00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     101736783    04150 mTOR signaling pathway     101736783   09133 Signaling molecules and interaction    04081 Hormone signaling     101736783  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101736783  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     101736783  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bmor04052]     101736783 Cytokines and neuropeptides [BR:bmor04052]  Neuropeptides   Unclassified    101736783 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  101736783 NCBI-ProteinID:  XP_004934106 UniProt:  Q17192 LinkDB All DBs Position 11:complement(6511112..6511933) Genome browser AA seq 92 aa AA seqDB search MKILLAIALMLSTVMWVSTQQPQRVHTYCGRHLARTLADLCWEAGVDKRSGAQFASYGSA WLMPYSEGRGKRGIVDECCLRPCSVDVLLSYC NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagatactccttgctattgcattaatgttgtcaacagtaatgtgggtgtcaacacaa cagccacaaagagtgcacacgtactgcgggcgtcacttggctcgcactctggccgacctg tgctgggaagcgggcgtggacaagcgcagcggtgctcagttcgcgagctacggctccgcg tggctgatgccgtactcggaaggacgcggcaaacgaggcatcgtggatgagtgctgtctc agaccctgcagcgtggacgtgcttctgtcgtactgttag

DBGET integrated database retrieval system