Bombyx mori (domestic silkworm): 101738475 Help Entry 101738475         CDS       T02817                                  Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism bmor  Bombyx mori (domestic silkworm) Pathway bmor04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:bmor00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     101738475  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bmor04121]     101738475    03400 DNA repair and recombination proteins [BR:bmor03400]     101738475 Ubiquitin system [BR:bmor04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      101738475    Cul5 complex      101738475 DNA repair and recombination proteins [BR:bmor03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      101738475 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  101738475 NCBI-ProteinID:  XP_004925259 UniProt:  A0A8R2AK94 LinkDB All DBs Position 6 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRKKLTVFTDAKETTTVLELKKMIEGILKVPPPSQMLFNKDSQLMEDEKTLAE FGLTSNTAKAHCPAPIGLALRKENGEFEALELTPYSSPPDLPDVMKSQETNGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttttaatgataaggcgaaaaaagcttactgtcttcactgatgcgaaggaa accactacagtattagagttgaagaaaatgattgaaggtatcctaaaggtacctcctcca agtcaaatgctgttcaacaaggacagccagctcatggaagatgagaagaccttggctgaa tttggcctgacctctaacacagcaaaggctcactgtccagcaccaattggattagctttg aggaaggagaatggtgaatttgaggcactggaacttaccccgtattcttcaccccccgac ttgccagatgttatgaaatctcaagagaccaatggacaggaacagatggatcaacattaa

DBGET integrated database retrieval system