Bombyx mori (domestic silkworm): 101740980 Help Entry 101740980         CDS       T02817                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism bmor  Bombyx mori (domestic silkworm) Pathway bmor04145   Phagocytosis bmor04814   Motor proteins Brite KEGG Orthology (KO) [BR:bmor00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     101740980   09142 Cell motility    04814 Motor proteins     101740980  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bmor03037]     101740980    04812 Cytoskeleton proteins [BR:bmor04812]     101740980 Cilium and associated proteins [BR:bmor03037]  Motile cilia and associated proteins   Dynein arm    101740980 Cytoskeleton proteins [BR:bmor04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      101740980 SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  101740980 NCBI-ProteinID:  XP_004931308 UniProt:  A0A8R1WNC4 LinkDB All DBs Position 7 Genome browser AA seq 115 aa AA seqDB search MAQEDDEEDLTFNVDEVQQIVRDNVELCLGGNAYSHSRTPQWITIITEKTLARLNKLNKP YKYIMRITITQKNGSGLHTAAAYYWDIATDGTCTVRWENKYMYCIVNIWALALQI NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggctcaagaggatgacgaagaggatttaacatttaacgtcgatgaagtgcaacagata gtaagagacaatgtagagttgtgtttgggcgggaacgcttatagtcactcaagaacgcca cagtggataactataatcacagagaagaccttagctcgattgaataaattaaacaagcct tacaaatatatcatgagaattaccataactcagaagaatggttccggtttgcatacagcc gctgcgtactactgggacatcgctacagatggcacgtgcacagtgcgttgggaaaataag tacatgtattgcattgtgaatatatgggcgcttgctcttcaaatatag

DBGET integrated database retrieval system