Bombyx mori (domestic silkworm): 692938 Help Entry 692938            CDS       T02817                                  Symbol Atg8 Name (RefSeq) autophagy related protein Atg8   KO K08341   GABA(A) receptor-associated protein Organism bmor  Bombyx mori (domestic silkworm) Pathway bmor04068   FoxO signaling pathway bmor04136   Autophagy - other bmor04137   Mitophagy - animal bmor04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:bmor00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     692938 (Atg8)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     692938 (Atg8)    04136 Autophagy - other     692938 (Atg8)    04137 Mitophagy - animal     692938 (Atg8)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bmor04131]     692938 (Atg8)    04121 Ubiquitin system [BR:bmor04121]     692938 (Atg8)    03029 Mitochondrial biogenesis [BR:bmor03029]     692938 (Atg8) Membrane trafficking [BR:bmor04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     692938 (Atg8) Ubiquitin system [BR:bmor04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    692938 (Atg8) Mitochondrial biogenesis [BR:bmor03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     692938 (Atg8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATG8 APG12 Motif Other DBs NCBI-GeneID:  692938 NCBI-ProteinID:  NP_001040244 UniProt:  Q2F5R5 Structure PDBPDBj LinkDB All DBs Position 11:complement(12320748..12321452) Genome browser AA seq 117 aa AA seqDB search MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaaattccaatacaaagaagaacattcatttgagaagagaaaggctgagggcgaaaaa atccgcaggaaatatccagatcgcgttcctgtaattgtagagaaagcgccgaaggctagg cttggagacctcgacaaaaagaagtatttagttccgtctgatttaacagttggccagttc tacttcttgatccggaaacgtattcacctgcggcctgaagacgcacttttcttcttcgtg aacaatgtcattccacccacatctgcaacaatggggtctctctaccaagaacaccatgat gaagatttctttctatacatagcattttccgacgaaaatgtctatggaaattaa

DBGET integrated database retrieval system