Bombyx mori (domestic silkworm): 732902 Help Entry 732902            CDS       T02817                                  Symbol Rab7 Name (RefSeq) Rab7   KO K07897   Ras-related protein Rab-7A Organism bmor  Bombyx mori (domestic silkworm) Pathway bmor04137   Mitophagy - animal bmor04140   Autophagy - animal bmor04144   Endocytosis bmor04145   Phagosome bmor04148   Efferocytosis Brite KEGG Orthology (KO) [BR:bmor00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     732902 (Rab7)    04145 Phagosome     732902 (Rab7)    04140 Autophagy - animal     732902 (Rab7)    04137 Mitophagy - animal     732902 (Rab7)    04148 Efferocytosis     732902 (Rab7)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bmor04131]     732902 (Rab7)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bmor04147]     732902 (Rab7)    04031 GTP-binding proteins [BR:bmor04031]     732902 (Rab7) Membrane trafficking [BR:bmor04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     732902 (Rab7) Exosome [BR:bmor04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    732902 (Rab7)   Exosomal proteins of other body fluids (saliva and urine)    732902 (Rab7)   Exosomal proteins of colorectal cancer cells    732902 (Rab7)   Exosomal proteins of bladder cancer cells    732902 (Rab7) GTP-binding proteins [BR:bmor04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     732902 (Rab7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 nSTAND3 cobW Septin AAA_16 AAA_24 PduV-EutP AAA_22 NACHT AAA_5 AAA_7 ATPase_2 NTPase_1 SRPRB G-alpha ABC_tran AAA_14 ATP-synt_ab NB-ARC TniB RNA_helicase PRK Motif Other DBs NCBI-GeneID:  732902 NCBI-ProteinID:  NP_001040368 UniProt:  Q1HQ77 LinkDB All DBs Position 15:7696255..7698146 Genome browser AA seq 208 aa AA seqDB search MSSRKKLLLKVIILGDSGVGKTSLMNQFVNKKFSNQYKATIGADFLTKEVIVDDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKSLESWRDEFLIQASPRDPDNFPF VILGNKVDLDNRAVSVKRGQQWCQSKNDIPYFETSAKEAVNVELAFQTIARNALAQETEA ELYNEFPDQIKLNANDNGRNRDGDNCAC NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgtcttcacggaaaaagctcctgctaaaggtaattatcctgggtgacagcggtgttgga aaaacatctctgatgaatcagtttgtcaacaaaaaattttccaaccagtacaaggcgaca ataggtgcagattttctcacaaaagaagtaatcgttgacgatagaatcgttacgatgcaa atatgggatactgctggccaagaacggttccaatcgcttggagtagctttctatcgtggg gcggattgctgcgtattagtttttgacgtaactgcccccaacacgtttaagtccttagag agttggagagacgaattcctgatacaggcatcacctcgtgaccctgataatttccccttc gtaatattgggaaacaaagtcgacttggataatcgtgccgtttctgtcaaacgtggtcaa caatggtgccagagcaagaacgacatcccgtattttgagacaagtgccaaagaagctgtc aatgtagagctagcttttcaaacaatagcacgcaacgcattggcacaagaaaccgaagct gaactctacaatgaattccccgaccaaatcaaactgaatgctaatgacaatggaagaaac agggacggtgacaactgtgcttgctag

DBGET integrated database retrieval system