KEGG   Bacillus velezensis JS25R: NG74_01141
Entry
NG74_01141        CDS       T03423                                 
Name
(GenBank) Purine-binding protein precursor
  KO
K05519  transcriptional activator of comK gene
Organism
bmp  Bacillus velezensis JS25R
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bmp03000]
    NG74_01141
Transcription factors [BR:bmp03000]
 Prokaryotic type
  Other transcription factors
   Others
    NG74_01141
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: AIU81251
UniProt: A0A7W4QG99
LinkDB
Position
1102555..1103415
AA seq 286 aa
MLFPDTISDLVWGTKGYKGLLAIQSEFNVDVYYKENIRSDEDILKAIDDFHKKGVNLLYG
HGNEYEEIFNMISKDYPDMEFVVANGTAKSDNVTSVHLMGEAMGFFGGMTAAHMSKNNEV
GVIASFLWQPEVDGFIKGAKYEKPDITVNTEFTDHWDNGNEALHLYEKLKAEGTDVVYPA
GDGYNVPVIQQIKKDGLYAIGYVAEQSNLGKNTVLTSTVQNVDKAYTLIAEQYNKGTLKS
GDHNFDFREGVVEMGTFSPLVDKAFQDKISDLVKTYNRTNELPSNE
NT seq 861 nt   +upstreamnt  +downstreamnt
atgctttttcccgataccatcagtgacttggtatgggggacaaaaggttacaaaggttta
ttagcgatacaatctgaatttaacgttgacgtttattataaagaaaatatcagatccgat
gaagatattttaaaagcgatagatgattttcataaaaaaggagtcaatcttttatacggg
cacggaaatgaatacgaggaaattttcaatatgatcagcaaggattatcccgacatggaa
ttcgtcgtcgcaaacggaacggcgaaaagcgataatgtcacaagcgttcatcttatggga
gaagcaatgggctttttcgggggaatgacggccgcccatatgtcaaaaaacaatgaggtc
ggcgtcatcgcctcttttttgtggcagcctgaagtagacggctttatcaaaggagcgaaa
tatgaaaagcctgatatcaccgtcaatactgaatttacggaccactgggataacggcaat
gaagcgctgcatctttacgagaagttaaaagcggaaggcacggatgttgtatatccggcc
ggagacgggtataatgttcctgtcattcagcaaatcaaaaaagacgggctttacgccatc
ggctatgtcgccgagcaatcgaatctcggcaaaaacacggtgctgacaagcacggtgcaa
aacgtagataaagcctatacattaattgccgagcaatataataaaggtacgctcaagagc
ggagatcacaacttcgatttcagggaaggagtcgttgaaatggggacgttcagccctctg
gtggacaaagcatttcaagacaaaatctcagaccttgtcaaaacgtataacagaacaaat
gaactgccgtcaaatgaatag

DBGET integrated database retrieval system