Bacillus velezensis JS25R: NG74_03716
Help
Entry
NG74_03716 CDS
T03423
Name
(GenBank) Transglycosylase associated protein
Organism
bmp
Bacillus velezensis JS25R
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Transgly_assoc
Gly-zipper_Omp
DUF6703
Motif
Other DBs
NCBI-ProteinID:
AIU83722
LinkDB
All DBs
Position
3728594..3728839
Genome browser
AA seq
81 aa
AA seq
DB search
MSFIVSLIVAIIIGWIGSLFVKGSMPGGIIGSMIAGLIGAWIGHGLLGTWGPHLAGFAII
PAIIGAAIVVFLFSLIARSRG
NT seq
246 nt
NT seq
+upstream
nt +downstream
nt
atgagttttatcgtatctctgattgtcgctattattatcggctggatcggaagtttattt
gtaaaaggcagtatgcccggaggaatcatcgggtcaatgatcgccggtctgatcggcgca
tggatcgggcacggactgctcggcacatggggtcctcaccttgccggctttgccatcatt
ccggcaatcatcggagctgcgatcgtggtattcttattcagcctgatcgccagaagcaga
ggataa
DBGET
integrated database retrieval system