Priestia megaterium QM B1551: BMQ_pBM50051 Help Entry BMQ_pBM50051      CDS       T01208                                  Name (GenBank) acyl carrier domain protein   KO K02078   acyl carrier protein Organism bmq  Priestia megaterium QM B1551 Pathway bmq00998   Biosynthesis of various antibiotics bmq01100   Metabolic pathways bmq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BMQ_pBM50051    00074 Mycolic acid biosynthesis     BMQ_pBM50051   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BMQ_pBM50051 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding_2 PP-binding Motif Other DBs NCBI-ProteinID:  ADE72390 UniProt:  D5E3L5 LinkDB All DBs Position pBM500:complement(32148..32447) Genome browser AA seq 99 aa AA seqDB search MSTITQNDLLEQVNERKQLCQQIKTEIVERLSLNIEPAWIADNQPLFGRGLELDSIDTLE ISIALQEVFDVMLTDDNMDVLGSVNKIADFITSQRNENL NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtcaacaataactcaaaatgatttattagaacaagttaatgaacgcaagcaactttgc caacaaataaaaacagaaattgtagaaagactttctctaaatatcgaacctgcatggatt gccgataatcaacctttatttggtagaggattagagttggattctatcgatacacttgaa atctcaattgctcttcaagaagtctttgatgttatgctaacagacgataatatggatgtt cttggttcagtaaataaaattgctgattttattacctctcaaaggaatgaaaatctatga

DBGET integrated database retrieval system