Brucella suis 1330: BR0459 Help Entry BR0459            CDS       T00096                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bms  Brucella suis 1330 Pathway bms01100   Metabolic pathways bms01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bms00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BR0459 (acpP)    00074 Mycolic acid biosynthesis     BR0459 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BR0459 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  AAN29402 UniProt:  P63438 LinkDB All DBs Position I:458169..458405 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgcagagcgcgtcaagaaaatcgttgttgaacatctgggcgtagatgcc gacaaggtcacggaaggcgcaagcttcattgatgacctcggcgcagacagcctcgacacc gtcgagctggtcatggcctttgaagaagaattcggcgttgaaattcctgacgacgctgcc gaaacgatccttacggtcggtgatgctgtgaagttcatcgataaggcttctgcctga

DBGET integrated database retrieval system