Brucella suis ATCC 23445: BSUIS_B0607
Help
Entry
BSUIS_B0607 CDS
T00638
Name
(GenBank) diguanylate cyclase (GGDEF) domain
KO
K02488
two-component system, cell cycle response regulator [EC:
2.7.7.65
]
Organism
bmt
Brucella suis ATCC 23445
Pathway
bmt02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
bmt00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
BSUIS_B0607
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
bmt02022
]
BSUIS_B0607
Enzymes [BR:
bmt01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.65 diguanylate cyclase
BSUIS_B0607
Two-component system [BR:
bmt02022
]
Cell cycle family
PleC-PleD (cell fate control)
BSUIS_B0607
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
GGDEF
Response_reg
PDE8A_N
GlnR_1st
GGDEF_2
Motif
Other DBs
NCBI-ProteinID:
ABY39595
UniProt:
A9WYS9
LinkDB
All DBs
Position
II:complement(597722..599107)
Genome browser
AA seq
461 aa
AA seq
DB search
MTARILVVDDVDSNVKLLEARLLSEYYEVVPAYSGAEAIEICLDGQIDIVLLDVLMPGLD
GFEVCRRLKANPRTANIPVIMITCLTSPEDKVRGLEAGAEDFLSKPVNDLELLSRLKSLT
RLKMMSDELFQRAGRIADAEVDALLARKMAGKDGNKDEIARILVVDEDELAAARLRHILD
ENYRVDVASDAETALIRAIETDYDTIIVSASFTYYDPLKLCTQLRTIQRTRLIPIILMVW
EDEGALVVRALELGVNDYLMRPLEKIELFARLRTQIKRKCYNDILRQSMERTITQSVTDG
LTGLHNRRYIDMHMPLLLTRAIERKQPLSIIMIDLDHFKQVNEQYGHGAGDHVLREFSGR
LRRNIRGMDLISRYGGEEFVVVLPDTDRQAAFNVAERVRGIVAEAPFVLDDGKRRASLTV
SVGVAALRPAGDSLEALFTRATDALIQAKQSGRNRIVLSAA
NT seq
1386 nt
NT seq
+upstream
nt +downstream
nt
atgacagcaaggattctcgtcgtcgatgatgtggactccaatgtaaagcttctcgaagcg
cgccttctcagcgaatattacgaagtcgttcccgcctatagcggcgccgaggcgattgaa
atctgtcttgatgggcagatcgacattgttcttctggatgtattgatgccggggcttgat
ggtttcgaggtttgccgacgcctgaaagccaatccgcgtacggcaaatattccagtcatt
atgattacgtgcctcaccagcccggaagacaaggtgcgcgggcttgaggcgggggcggaa
gattttctctcaaagcctgtcaacgatcttgaactcctgtcacggctgaaaagccttacc
cggctcaagatgatgtcggacgagctgttccagcgcgccggccggattgcggatgccgaa
gtggatgccctccttgcgcgcaagatggcgggtaaagacggcaataaagatgagatcgcc
cgcattcttgtggtggatgaggatgaactggcggccgcgcgccttcgccatattctggat
gagaattatcgggtcgatgtggcgagtgacgccgaaaccgcactgatccgcgctattgaa
acagattacgacacgatcatcgtttcggcctccttcacctattatgatccgctgaaacta
tgcacgcaattgcgcacaatccagcgcacgcggctcataccgatcatcctgatggtgtgg
gaagacgagggcgcactggtggtgcgtgcactggaactgggcgtgaacgactatctgatg
cgcccattggagaagatagaactgtttgcgcggctgcgcacacagatcaagcgcaaatgc
tataatgatattctgcgccagagcatggagcgcactattacccaatcggtgacggacggc
ctcacggggctgcataaccgccgctacatcgacatgcacatgccgctgctgctcacacgc
gcaatcgagcgcaagcagcccctctcgatcatcatgatcgatcttgatcacttcaagcag
gtcaacgaacaatatggccatggcgcgggcgatcatgtgttgcgggaattttcgggccgt
ttgcgcaggaatattcgcggcatggatcttatcagccgctacggtggtgaggaatttgtc
gtcgtgctgccggacacggacaggcaggctgccttcaatgtggctgagcgcgtgcggggt
atcgtagccgaagctccctttgtgctcgatgacggaaagcgcagggccagcctgacggtc
agcgtgggcgttgcagcacttcggcccgcaggcgacagccttgaggcgcttttcacccgc
gcgaccgacgcgctcattcaggcgaagcagagcggacgaaatcgcattgttttatccgcg
gcctga
DBGET
integrated database retrieval system