Burkholderia multivorans ATCC BAA-247: NP80_1226 Help Entry NP80_1226         CDS       T03881                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bmul  Burkholderia multivorans ATCC BAA-247 Pathway bmul00998   Biosynthesis of various antibiotics bmul01100   Metabolic pathways bmul01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmul00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NP80_1226 (acpP)    00074 Mycolic acid biosynthesis     NP80_1226 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NP80_1226 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AJY17448 LinkDB All DBs Position 1:1287695..1287934 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgtgtcaagaagatcgtcgccgaacagctgggcgtcgccgaa gccgagatcaagaacgaagcttcgttcgtgaacgacctgggcgccgactcgctcgacacc gtcgaactggtgatggctctggaagacgagttcggcatggaaatcccggacgaagaggcg gagaagatcacgacggttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system