Burkholderia multivorans ATCC BAA-247: NP80_3521
Help
Entry
NP80_3521 CDS
T03881
Name
(GenBank) response regulator
KO
K07677
two-component system, NarL family, capsular synthesis sensor histidine kinase RcsC [EC:
2.7.13.3
]
Organism
bmul
Burkholderia multivorans ATCC BAA-247
Pathway
bmul02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
bmul00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
NP80_3521
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:
bmul01001
]
NP80_3521
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
bmul02022
]
NP80_3521
Enzymes [BR:
bmul01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.13 Protein-histidine kinases
2.7.13.3 histidine kinase
NP80_3521
Protein kinases [BR:
bmul01001
]
Histidine kinases
NarL family
NP80_3521
Two-component system [BR:
bmul02022
]
NarL family
RcsC-RcsD-RcsB (capsule synthesis)
NP80_3521
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
HATPase_c
Response_reg
HisKA
Hpt
Motif
Other DBs
NCBI-ProteinID:
AJY16295
LinkDB
All DBs
Position
2:367870..370875
Genome browser
AA seq
1001 aa
AA seq
DB search
MPKELKKLAARSASATVKRFEPARVRRQQRALLYGGGAAVTVFILACAVLIVLLDVSDFL
ARARSAFLGREAELHAELQVANALLTHHADSIEMFERTDPRATPAQLRRLDDAHGRLIVS
GRAGMPSTAVLADLTHDRGAAAYSRYVALLFQQTDMIAVSMPHTINAGLSAYLIGTGGDF
IGIVGVQPVGRLTGRLDAIDMHALIRSVEPHRGIGVPLRTIDGRDDALLDTRDDTLLGRP
VWRLSRPVRDASGQPIAWLVINTRAQVAAIMKPDYADDTHALVDARGTVAIGAPVPAALV
ERALAFARAPGDVRAAVHRVGTRFVIGDRLPESDLVFVTTFSWRSVVEALAVSLGATAGA
ALFAIAALWLAVVAFDRRALRPAYRRAIRLIESDALNRALIRTAPAGLALLSLADGDDIV
CNETMTRYERLTSDAPLGKRLWRAYREHRDASGYAKVVTCELPIAPDRPDTPHVVANIMR
TRYRGVDALLCTLTDITARKQMEQKLHEARVAAESANKAKSTFLATMSHEIRTPLNAIVG
NLELMARAPLAPTERRRLDTIASSSDALLRIIDDVLDLSKAESNQMTIERIPFDVRDVLD
DIAAFYRPLASAKGLELTCRVAPELADGYVGDPVRLRQIVSNLVDNAIKFTERGCVSIDV
RRVVRGAGGARVEIRVADTGIGIPADSVPTLFDVYIQADASIYRRFGGTGLGLPLCRRIA
MLMHGDLTVDSREREGTTMRVTLPLPEAPPNWRAAQPGATAQAAPGSIDVARDAAPIRVL
VAEDHPASRALLRDQLEALHHSATIVENGIQAMRAFFEAPFDVVLTDLGMPELDGYALAN
FLREQRAGVPVIAMTAHATEDDYRRCEQVGIAELVLKPLSIAVLDAALTRHAGQRAASAR
DTADVAYDAPSVLSDDVRDTLRAATRRSMALLGDAAARGDVATLRLELHSMRGGFALAGD
ADACDACAAMERAVEAGTVDANWPDFQHAIARALARLDADA
NT seq
3006 nt
NT seq
+upstream
nt +downstream
nt
atgcccaaggaactgaaaaagctcgccgcgcgcagcgcgtccgccaccgtcaaacgattc
gagccggcccgcgtgcgccgtcagcagcgcgcgctgctgtacggcggcggcgcggccgtc
accgtgtttatcctcgcctgcgcggtgttgatcgtcttgctcgacgtgtcggacttcctc
gctcgggcgcgctccgcgtttctcgggcgcgaggccgagctgcatgcggagctgcaggtc
gcgaacgcgctgctcacgcatcacgcggacagcatcgagatgttcgagcgcaccgatccg
cgcgcgacgcccgctcagctacgccggctcgacgacgcgcacggccggctgatcgtcagc
ggccgcgcggggatgccgtcgaccgccgtgctcgcggaccttacgcacgatcgcggcgcc
gcagcgtactcgcggtacgtcgcgctgctgtttcagcagaccgacatgatcgcggtgtcg
atgccgcacacgatcaacgcggggctcagcgcctatctgatcggcacggggggcgacttc
atcggcatcgtcggcgttcagccggtcggccggctgacgggccggctcgatgcgatcgac
atgcatgcgctgattcgcagcgtcgagccgcaccgcggtatcggcgtgccgctgcgcacg
atcgacggccgcgacgacgcgctgctcgacacgcgcgacgatacgctgctcggccgcccc
gtatggcgactctcgcggcccgtgcgcgatgcgtccgggcagccgatcgcctggctcgtg
atcaacacgcgcgcgcaggtcgccgcgatcatgaagcccgactatgcggacgacacgcat
gcgctcgtcgacgcgcgcggaacggtcgcgatcggcgcgccggtcccggcggcgctcgtc
gagcgtgcgcttgcgttcgcgcgtgcgccgggcgacgtgcgtgcggccgtgcatcgcgtc
ggcacgcgcttcgtgatcggcgatcgtctgcccgaatccgatctcgtgttcgtcacgacg
ttctcgtggcgcagcgtcgtcgaagcgctggcggtgtcgctcggtgcgacggccggcgcg
gcgctgttcgcgatcgccgcgctgtggctcgcggtcgtcgcgttcgatcggcgcgcgctg
cgtccggcctatcgccgtgcgatccggctgatcgaaagcgatgcgctgaaccgcgcgttg
atccgcaccgcgccggcaggcctcgcgctgttgtcgctcgcggacggcgacgacatcgtc
tgcaacgaaacgatgacgcgctacgagcggctgacgtcggacgcgccgctcggcaagcgg
ctgtggcgcgcctatcgcgagcatcgcgacgcgagcggctacgcgaaggtcgtcacgtgc
gagctgccgatcgctccggaccggcccgatacgccgcatgtcgtcgcgaacatcatgcgt
acgcgctatcgcggtgtcgacgcgctgctgtgcacgctgaccgacatcaccgcgcgcaag
cagatggagcagaagctgcacgaggcgcgcgtcgccgcggagtccgcgaacaaggcgaag
tcgacattcctcgcgacgatgagccacgagatccgcacgccgctgaacgcgatcgtcggc
aacctcgagctgatggcgcgcgcgccgctcgcgccgaccgagcggcggcggctcgacacg
atcgcgtcgtcatcggacgcgttgctgcggatcatcgacgacgtgctcgacctgtcgaag
gccgagtcgaaccagatgacgatcgagcgcatcccgttcgacgtgcgcgacgtactggac
gacatcgccgcgttctatcgcccgctcgcgagcgcgaaagggctggagctgacgtgccgc
gtggcgcccgagctggccgacggatacgtcggcgacccggtgcggctgcgtcagatcgtg
tcgaatctcgtcgacaacgcgatcaagttcacggagcgcggctgcgtgtcgatcgatgtg
cgacgggtggtgcgcggcgcgggcggcgcgcgcgtcgagatccgcgtcgcggacaccggg
atcgggataccggccgacagcgtgccgacgctgttcgacgtgtacatccaggccgacgcg
tcgatctaccgccgcttcggcggcacggggctcgggctgccgctgtgccggcgcatcgcg
atgctgatgcacggcgatcttaccgtcgacagccgcgaacgcgaaggcacgacgatgcgc
gtgacgttgccgctgccggaagcgccgccgaactggcgcgccgcgcagccgggagcgacg
gcgcaagcggcgccgggcagcatcgacgtcgcgcgcgacgcggcgccgattcgcgtgctg
gtcgccgaagaccatccggcgagccgcgcgctgctgcgcgatcagctggaagcgctgcat
cacagcgcgacgatcgtcgagaacggcatccaggcgatgcgcgcgttcttcgaagcgccg
ttcgacgtcgtgctgaccgatctcgggatgccggaactcgacggttatgcactcgcgaat
ttcctgcgcgagcagcgtgcgggcgtgcccgtgatcgcgatgaccgcgcacgcgacggag
gacgactatcgtcgctgcgagcaggtcggtatcgcggaactcgtgctgaagccgttgtcg
atcgcggtgctcgatgcggcgctgacgcggcatgccggccagcgcgccgcatcggcgcgc
gatacggcggatgtcgcgtacgacgcaccgtccgtgttgtcggacgacgtgcgcgatacg
ctgcgcgcggcaacgcgccgctcgatggcattgctcggcgacgcggcggcacgcggcgat
gtcgcgacgctgcggctcgaactgcattcgatgcgaggcggtttcgcgcttgccggcgat
gccgatgcgtgcgacgcctgcgcggcgatggagcgcgcggtcgaggcggggaccgtcgac
gcgaactggccggacttccagcacgcgatcgcgcgtgcgctggcccggctcgacgccgac
gcgtaa
DBGET
integrated database retrieval system