Burkholderia multivorans ATCC BAA-247: NP80_4739 Help Entry NP80_4739         CDS       T03881                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bmul  Burkholderia multivorans ATCC BAA-247 Brite KEGG Orthology (KO) [BR:bmul00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmul03036]     NP80_4739    03400 DNA repair and recombination proteins [BR:bmul03400]     NP80_4739 Chromosome and associated proteins [BR:bmul03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     NP80_4739 DNA repair and recombination proteins [BR:bmul03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       NP80_4739 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS YjcZ MobI ERM_C Motif Other DBs NCBI-ProteinID:  AJY17189 LinkDB All DBs Position 2:1782155..1782457 Genome browser AA seq 100 aa AA seqDB search MPTKNYRDLKEQLAKLQKEAEAARIAEMEAVIAEIREKVAEYGITSEQIFGRQRAGRTKA ATPSAPKYRNPKTGETWTGRGRAPGWIKDVKNRDRFLIQE NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccgacgaaaaattacagggacctgaaggagcagcttgcaaaattgcaaaaagaagcg gaagccgcgcgcattgcggaaatggaagccgtgatcgcggagatccgcgaaaaggtcgcc gagtacggcattacatcggagcagattttcggacggcagcgcgccggcagaaccaaggcc gccacgccgtccgcgccgaagtaccgcaacccgaagacgggagaaacatggaccgggcgc ggccgcgcaccgggctggatcaaggacgtgaagaatcgcgatcgcttcctgatccaggaa tga

DBGET integrated database retrieval system