KEGG   Peribacillus muralis: ABE28_019115
Entry
ABE28_019115      CDS       T05340                                 

Definition
(GenBank) bacilysin biosynthesis protein BacA
  KO
K19546  prephenate decarboxylase [EC:4.1.1.100]
Organism
bmur  Peribacillus muralis
Pathway
bmur00998  Biosynthesis of various secondary metabolites - part 2
bmur01100  Metabolic pathways
bmur01110  Biosynthesis of secondary metabolites
Module
bmur_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    ABE28_019115
Enzymes [BR:bmur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.100  prephenate decarboxylase
     ABE28_019115
SSDB
Motif
Pfam: PDT
Other DBs
NCBI-ProteinID: AOH56481
UniProt: A0A1B3XTE1
LinkDB
Position
3932174..3932764
AA seq 196 aa
MIILNDLTKEKIQTPLKTIKVGTLGPSGTSSEFAANLFMDNYLFNQGIFSELILFQTFEE
SMENLEKGLLDYIIVPHAYGGINEFYMKSNIDLIQLFRCDTPMYGLAVRKGFPYHKELLD
SETIVSHPAPINLLKYFLNTKAKIHTVNSTSVAANLVKESVYNIAITNEVAKEKYGLDFV
YQFKHIPMSWSVFGRR
NT seq 591 nt   +upstreamnt  +downstreamnt
ttgataattttaaatgatttgaccaaagaaaaaatacagactcctttgaagactatcaaa
gtaggaactctaggaccttctggtacaagtagtgagtttgcagctaatctctttatggac
aattatctatttaatcaagggatattcagtgagttgattctttttcaaactttcgaagaa
agtatggaaaacttagaaaaaggattactggattacattattgttcctcatgcatacgga
ggaattaatgagttttacatgaaatccaatattgatttaattcaattgtttcgttgtgat
acaccaatgtatggtttagctgtaagaaaaggatttccatatcataaagaattattagac
tcagagacaattgtttctcatccggcacccatcaacctattaaagtattttttaaataca
aaggccaaaattcatactgtaaattctactagtgtagcagcaaacttagtaaaagaatca
gtttacaatatcgccattaccaatgaagtagctaaagagaaatatggtctggattttgtt
tatcaatttaaacatatacccatgagttggtccgtatttggaaggagataa

DBGET integrated database retrieval system