KEGG   Balaenoptera musculus (blue whale): 118880663
Entry
118880663         CDS       T09887                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bmus  Balaenoptera musculus (blue whale)
Pathway
bmus01521  EGFR tyrosine kinase inhibitor resistance
bmus01522  Endocrine resistance
bmus01524  Platinum drug resistance
bmus04010  MAPK signaling pathway
bmus04012  ErbB signaling pathway
bmus04014  Ras signaling pathway
bmus04015  Rap1 signaling pathway
bmus04022  cGMP-PKG signaling pathway
bmus04024  cAMP signaling pathway
bmus04062  Chemokine signaling pathway
bmus04066  HIF-1 signaling pathway
bmus04068  FoxO signaling pathway
bmus04071  Sphingolipid signaling pathway
bmus04072  Phospholipase D signaling pathway
bmus04114  Oocyte meiosis
bmus04140  Autophagy - animal
bmus04148  Efferocytosis
bmus04150  mTOR signaling pathway
bmus04151  PI3K-Akt signaling pathway
bmus04210  Apoptosis
bmus04218  Cellular senescence
bmus04261  Adrenergic signaling in cardiomyocytes
bmus04270  Vascular smooth muscle contraction
bmus04350  TGF-beta signaling pathway
bmus04360  Axon guidance
bmus04370  VEGF signaling pathway
bmus04371  Apelin signaling pathway
bmus04380  Osteoclast differentiation
bmus04510  Focal adhesion
bmus04520  Adherens junction
bmus04540  Gap junction
bmus04550  Signaling pathways regulating pluripotency of stem cells
bmus04611  Platelet activation
bmus04613  Neutrophil extracellular trap formation
bmus04620  Toll-like receptor signaling pathway
bmus04621  NOD-like receptor signaling pathway
bmus04625  C-type lectin receptor signaling pathway
bmus04650  Natural killer cell mediated cytotoxicity
bmus04657  IL-17 signaling pathway
bmus04658  Th1 and Th2 cell differentiation
bmus04659  Th17 cell differentiation
bmus04660  T cell receptor signaling pathway
bmus04662  B cell receptor signaling pathway
bmus04664  Fc epsilon RI signaling pathway
bmus04666  Fc gamma R-mediated phagocytosis
bmus04668  TNF signaling pathway
bmus04713  Circadian entrainment
bmus04720  Long-term potentiation
bmus04722  Neurotrophin signaling pathway
bmus04723  Retrograde endocannabinoid signaling
bmus04724  Glutamatergic synapse
bmus04725  Cholinergic synapse
bmus04726  Serotonergic synapse
bmus04730  Long-term depression
bmus04810  Regulation of actin cytoskeleton
bmus04910  Insulin signaling pathway
bmus04912  GnRH signaling pathway
bmus04914  Progesterone-mediated oocyte maturation
bmus04915  Estrogen signaling pathway
bmus04916  Melanogenesis
bmus04917  Prolactin signaling pathway
bmus04919  Thyroid hormone signaling pathway
bmus04921  Oxytocin signaling pathway
bmus04926  Relaxin signaling pathway
bmus04928  Parathyroid hormone synthesis, secretion and action
bmus04929  GnRH secretion
bmus04930  Type II diabetes mellitus
bmus04933  AGE-RAGE signaling pathway in diabetic complications
bmus04934  Cushing syndrome
bmus04935  Growth hormone synthesis, secretion and action
bmus04960  Aldosterone-regulated sodium reabsorption
bmus05010  Alzheimer disease
bmus05020  Prion disease
bmus05022  Pathways of neurodegeneration - multiple diseases
bmus05034  Alcoholism
bmus05132  Salmonella infection
bmus05133  Pertussis
bmus05135  Yersinia infection
bmus05140  Leishmaniasis
bmus05142  Chagas disease
bmus05145  Toxoplasmosis
bmus05152  Tuberculosis
bmus05160  Hepatitis C
bmus05161  Hepatitis B
bmus05163  Human cytomegalovirus infection
bmus05164  Influenza A
bmus05165  Human papillomavirus infection
bmus05166  Human T-cell leukemia virus 1 infection
bmus05167  Kaposi sarcoma-associated herpesvirus infection
bmus05170  Human immunodeficiency virus 1 infection
bmus05171  Coronavirus disease - COVID-19
bmus05200  Pathways in cancer
bmus05203  Viral carcinogenesis
bmus05205  Proteoglycans in cancer
bmus05206  MicroRNAs in cancer
bmus05207  Chemical carcinogenesis - receptor activation
bmus05208  Chemical carcinogenesis - reactive oxygen species
bmus05210  Colorectal cancer
bmus05211  Renal cell carcinoma
bmus05212  Pancreatic cancer
bmus05213  Endometrial cancer
bmus05214  Glioma
bmus05215  Prostate cancer
bmus05216  Thyroid cancer
bmus05218  Melanoma
bmus05219  Bladder cancer
bmus05220  Chronic myeloid leukemia
bmus05221  Acute myeloid leukemia
bmus05223  Non-small cell lung cancer
bmus05224  Breast cancer
bmus05225  Hepatocellular carcinoma
bmus05226  Gastric cancer
bmus05230  Central carbon metabolism in cancer
bmus05231  Choline metabolism in cancer
bmus05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bmus05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bmus00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    118880663 (MAPK3)
   04012 ErbB signaling pathway
    118880663 (MAPK3)
   04014 Ras signaling pathway
    118880663 (MAPK3)
   04015 Rap1 signaling pathway
    118880663 (MAPK3)
   04350 TGF-beta signaling pathway
    118880663 (MAPK3)
   04370 VEGF signaling pathway
    118880663 (MAPK3)
   04371 Apelin signaling pathway
    118880663 (MAPK3)
   04668 TNF signaling pathway
    118880663 (MAPK3)
   04066 HIF-1 signaling pathway
    118880663 (MAPK3)
   04068 FoxO signaling pathway
    118880663 (MAPK3)
   04072 Phospholipase D signaling pathway
    118880663 (MAPK3)
   04071 Sphingolipid signaling pathway
    118880663 (MAPK3)
   04024 cAMP signaling pathway
    118880663 (MAPK3)
   04022 cGMP-PKG signaling pathway
    118880663 (MAPK3)
   04151 PI3K-Akt signaling pathway
    118880663 (MAPK3)
   04150 mTOR signaling pathway
    118880663 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    118880663 (MAPK3)
   04148 Efferocytosis
    118880663 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    118880663 (MAPK3)
   04210 Apoptosis
    118880663 (MAPK3)
   04218 Cellular senescence
    118880663 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    118880663 (MAPK3)
   04520 Adherens junction
    118880663 (MAPK3)
   04540 Gap junction
    118880663 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    118880663 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    118880663 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    118880663 (MAPK3)
   04613 Neutrophil extracellular trap formation
    118880663 (MAPK3)
   04620 Toll-like receptor signaling pathway
    118880663 (MAPK3)
   04621 NOD-like receptor signaling pathway
    118880663 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    118880663 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    118880663 (MAPK3)
   04660 T cell receptor signaling pathway
    118880663 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    118880663 (MAPK3)
   04659 Th17 cell differentiation
    118880663 (MAPK3)
   04657 IL-17 signaling pathway
    118880663 (MAPK3)
   04662 B cell receptor signaling pathway
    118880663 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    118880663 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    118880663 (MAPK3)
   04062 Chemokine signaling pathway
    118880663 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    118880663 (MAPK3)
   04929 GnRH secretion
    118880663 (MAPK3)
   04912 GnRH signaling pathway
    118880663 (MAPK3)
   04915 Estrogen signaling pathway
    118880663 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    118880663 (MAPK3)
   04917 Prolactin signaling pathway
    118880663 (MAPK3)
   04921 Oxytocin signaling pathway
    118880663 (MAPK3)
   04926 Relaxin signaling pathway
    118880663 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    118880663 (MAPK3)
   04919 Thyroid hormone signaling pathway
    118880663 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    118880663 (MAPK3)
   04916 Melanogenesis
    118880663 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    118880663 (MAPK3)
   04270 Vascular smooth muscle contraction
    118880663 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    118880663 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    118880663 (MAPK3)
   04725 Cholinergic synapse
    118880663 (MAPK3)
   04726 Serotonergic synapse
    118880663 (MAPK3)
   04720 Long-term potentiation
    118880663 (MAPK3)
   04730 Long-term depression
    118880663 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    118880663 (MAPK3)
   04722 Neurotrophin signaling pathway
    118880663 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    118880663 (MAPK3)
   04380 Osteoclast differentiation
    118880663 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    118880663 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118880663 (MAPK3)
   05206 MicroRNAs in cancer
    118880663 (MAPK3)
   05205 Proteoglycans in cancer
    118880663 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    118880663 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    118880663 (MAPK3)
   05203 Viral carcinogenesis
    118880663 (MAPK3)
   05230 Central carbon metabolism in cancer
    118880663 (MAPK3)
   05231 Choline metabolism in cancer
    118880663 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    118880663 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    118880663 (MAPK3)
   05212 Pancreatic cancer
    118880663 (MAPK3)
   05225 Hepatocellular carcinoma
    118880663 (MAPK3)
   05226 Gastric cancer
    118880663 (MAPK3)
   05214 Glioma
    118880663 (MAPK3)
   05216 Thyroid cancer
    118880663 (MAPK3)
   05221 Acute myeloid leukemia
    118880663 (MAPK3)
   05220 Chronic myeloid leukemia
    118880663 (MAPK3)
   05218 Melanoma
    118880663 (MAPK3)
   05211 Renal cell carcinoma
    118880663 (MAPK3)
   05219 Bladder cancer
    118880663 (MAPK3)
   05215 Prostate cancer
    118880663 (MAPK3)
   05213 Endometrial cancer
    118880663 (MAPK3)
   05224 Breast cancer
    118880663 (MAPK3)
   05223 Non-small cell lung cancer
    118880663 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    118880663 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    118880663 (MAPK3)
   05161 Hepatitis B
    118880663 (MAPK3)
   05160 Hepatitis C
    118880663 (MAPK3)
   05171 Coronavirus disease - COVID-19
    118880663 (MAPK3)
   05164 Influenza A
    118880663 (MAPK3)
   05163 Human cytomegalovirus infection
    118880663 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    118880663 (MAPK3)
   05165 Human papillomavirus infection
    118880663 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    118880663 (MAPK3)
   05135 Yersinia infection
    118880663 (MAPK3)
   05133 Pertussis
    118880663 (MAPK3)
   05152 Tuberculosis
    118880663 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    118880663 (MAPK3)
   05140 Leishmaniasis
    118880663 (MAPK3)
   05142 Chagas disease
    118880663 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118880663 (MAPK3)
   05020 Prion disease
    118880663 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    118880663 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    118880663 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118880663 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    118880663 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    118880663 (MAPK3)
   04934 Cushing syndrome
    118880663 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    118880663 (MAPK3)
   01524 Platinum drug resistance
    118880663 (MAPK3)
   01522 Endocrine resistance
    118880663 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bmus01001]
    118880663 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bmus03036]
    118880663 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmus04147]
    118880663 (MAPK3)
Enzymes [BR:bmus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     118880663 (MAPK3)
Protein kinases [BR:bmus01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   118880663 (MAPK3)
Chromosome and associated proteins [BR:bmus03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     118880663 (MAPK3)
Exosome [BR:bmus04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   118880663 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 118880663
NCBI-ProteinID: XP_036680322
UniProt: A0A8B8V659
LinkDB
Position
15:71653133..71659743
AA seq 412 aa
MAAAAAAQGGGGGEPRGTDGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DPKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEVGQPPAAGLAGRWMGGHPSV
PVLSLPTSLPPQPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGVLEAP
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggctcaggggggcgggggcggggagccccggggaactgatggg
gtcggcccgggggtcccgggggaagtagagatagtaaaggggcagccgttcgacgtgggc
ccgcgctacacgcagctgcagtacatcggcgagggcgcgtatggcatggtcagctcagct
tacgaccacgtgcgcaagactcgagtggccatcaagaaaatcagcccctttgagcatcag
acctactgccagcgtacgttgcgagagatccagatcttgctgcgcttccgccatgagaac
gtcatcggcatccgagacattctgcgggcacccaccctggaagccatgagggatgtctac
attgtgcaagacctgatggagacagacctgtacaagttgcttaaaagccagcagctgagc
aacgaccacatctgctacttcctctaccaaatcctgcggggcctcaagtatatccactcc
gccaatgtgctccaccgggatttaaagccctccaacctgctcatcaacaccacctgcgac
cttaagatctgtgattttggtcttgcccggatcgccgatcctgagcacgaccacactggc
tttctgacggaatacgtggccacacgctggtaccgggccccagagatcatgcttaactcc
aagggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctc
tccaaccggcccatcttcccgggcaagcactacctggaccagctcaaccacattctgggt
atcctgggctccccctcccaggaggacctgaattgtatcatcaacatgaaggcccgaaac
tacctacagtctctaccctccaagaccaaggtggcctgggccaagctttttcccaagtcg
gaccccaaagctcttgacctgctggaccggatgttgacctttaaccccaacaaacggatc
acagtggaagaagcactggctcacccctacctggagcagtactacgacccaacagatgag
gtgggccagccaccagcagcagggctggcgggtaggtggatgggtgggcatccctcagtc
cctgtcctgagcctccccacttctttgccaccccagccagtggccgaggaacctttcacc
ttcgacatggagctggatgatctacccaaggagcggctgaaggagctcatcttccaggag
acagcccgcttccagcctggggtgctggaggccccctaa

DBGET integrated database retrieval system