Balaenoptera musculus (blue whale): 118880701 Help Entry 118880701         CDS       T09887                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04066   HIF-1 signaling pathway bmus04120   Ubiquitin mediated proteolysis bmus05170   Human immunodeficiency virus 1 infection bmus05200   Pathways in cancer bmus05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:bmus00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     118880701  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     118880701  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118880701   09162 Cancer: specific types    05211 Renal cell carcinoma     118880701   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     118880701  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bmus04121]     118880701    03400 DNA repair and recombination proteins [BR:bmus03400]     118880701 Ubiquitin system [BR:bmus04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      118880701    Cul5 complex      118880701 DNA repair and recombination proteins [BR:bmus03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      118880701 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Motif Other DBs NCBI-GeneID:  118880701 NCBI-ProteinID:  XP_036680420 UniProt:  A0A8B8V6R0 LinkDB All DBs Position 1:72482058..72482493 Genome browser AA seq 118 aa AA seqDB search MYVFLTIRRHKTTIFTDAKDSNTLFELKRIVEGILKRPPDKQQMYKDDQLLDHGKTLGEC GFTSQTARPQAPATVGLAFRADEAFETLSTEPFYSPPELPDVMKPQDLGSSANEQALQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgtacgtgttcctcacgatccggcgccacaagaccaccatcttcacggacgccaaggac tcgaacaccttgttcgagctgaagcgcatcgtcgaaggcatcctcaagcggccaccagac aagcagcagatgtacaaggacgaccagcttctggaccacggaaagacactgggagagtgt ggcttcaccagccagacagcacgacctcaggccccagccactgtggggctagccttcagg gcagatgaagcctttgagacccttagcaccgagcccttctacagcccaccagagctgccg gatgtgatgaagccgcaggacttaggaagcagcgctaatgaacaagctctgcagtga

DBGET integrated database retrieval system