Balaenoptera musculus (blue whale): 118881610 Help Entry 118881610         CDS       T09887                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04066   HIF-1 signaling pathway bmus04120   Ubiquitin mediated proteolysis bmus05170   Human immunodeficiency virus 1 infection bmus05200   Pathways in cancer bmus05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:bmus00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     118881610  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     118881610  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118881610   09162 Cancer: specific types    05211 Renal cell carcinoma     118881610   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     118881610  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bmus04121]     118881610    03400 DNA repair and recombination proteins [BR:bmus03400]     118881610 Ubiquitin system [BR:bmus04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      118881610    Cul5 complex      118881610 DNA repair and recombination proteins [BR:bmus03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      118881610 BRITE hierarchy Motif Pfam:  ubiquitin DUF2967 Motif Other DBs NCBI-GeneID:  118881610 NCBI-ProteinID:  XP_036682628 LinkDB All DBs Position 15:37310000..37312519 Genome browser AA seq 174 aa AA seqDB search MPSSLKTKEEGCGVGVWGEKSTQAGRGGAGPPGSGTLGAGVWAARKGAELPASRRGEAVA GVDVFLKIRHLKTIIFMEGKESSTMFLLKHIVEGILKQLPDEQRLYKHHRFLDDGKILGE CGLTSQTQPRVGLALQAGEAFETLPIKPFSSPPELRDVMKPQDPGSSANEQAVQ NT seq 525 nt NT seq  +upstreamnt  +downstreamnt atgccatcttcacttaaaacaaaagaagaagggtgtggggtgggggtgtggggagaaaaa tcaacgcaggcggggcggggcggggcggggccaccgggttcgggcaccctgggggccggc gtgtgggctgccaggaagggggcggagctgccggctagtcgaaggggagaggcagtagcc ggtgtggacgtgttcctcaaaatccggcacctcaagaccatcatcttcatggagggcaaa gagtccagcaccatgttcctgttgaagcacatcgtcgagggcatccttaagcagctgcca gacgagcagcggctgtacaagcaccaccggtttctggacgatggcaagatattgggtgag tgtggcctcaccagccagacccagccgcgggtggggctagccttacaggcaggtgaagca tttgagaccctgcccatcaagcccttctccagcccaccggagctgcgggatgtgatgaag ccgcaggacccaggaagcagcgctaatgaacaagctgtgcagtga

DBGET integrated database retrieval system