Balaenoptera musculus (blue whale): 118881995 Help Entry 118881995         CDS       T09887                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04613   Neutrophil extracellular trap formation bmus05034   Alcoholism bmus05202   Transcriptional misregulation in cancer bmus05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bmus00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     118881995  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     118881995   09163 Immune disease    05322 Systemic lupus erythematosus     118881995   09165 Substance dependence    05034 Alcoholism     118881995  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmus03036]     118881995   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bmus04147]     118881995 Chromosome and associated proteins [BR:bmus03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118881995 Exosome [BR:bmus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118881995 SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF CENP-T_C CENP-S YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  118881995 NCBI-ProteinID:  XP_036683359 UniProt:  A0A8C0HZ77 LinkDB All DBs Position 15 Genome browser AA seq 127 aa AA seqDB search MARTKQTARKATGGKAPRKKLATKAARKSAPSTGGVKKPHRYRPGTVALREIRCYQKSIE LLICKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDPSLCAIHAKRVTI MPKDIQL NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaagcgaccggtggtaaagcaccgaggaaaaaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtaccgtggcgctccgtgaaattagatgttatcagaagtccattgaa cttctgatttgcaaacttcccttccagcgtctggtgcgggaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagaccccagcctgtgtgctatccacgccaaacgtgtaacaatt atgccaaaagacatccagctatag

DBGET integrated database retrieval system