Balaenoptera musculus (blue whale): 118884973 Help Entry 118884973         CDS       T09887                                  Name (RefSeq) metallothionein-1E   KO K14739   metallothionein 1/2 Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04978   Mineral absorption Brite KEGG Orthology (KO) [BR:bmus00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     118884973  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bmus03019]     118884973    03029 Mitochondrial biogenesis [BR:bmus03029]     118884973 Messenger RNA biogenesis [BR:bmus03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      118884973 Mitochondrial biogenesis [BR:bmus03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     118884973 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  118884973 NCBI-ProteinID:  XP_036689093 UniProt:  A0A8C0I3E3 LinkDB All DBs Position 19:complement(31454711..31456479) Genome browser AA seq 61 aa AA seqDB search MDPKCSCPTGGSCSCAGSCTCKACRCTSCKKSCCSCCPVGCAKCAQGCVCKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaagtgctcctgccccactggcggctcctgcagctgcgctggctcctgcacc tgcaaagcctgcagatgcacctcctgcaagaagagctgctgctcctgctgccccgtgggc tgcgccaagtgtgcccagggctgcgtctgcaaaggggcctcggacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system