Balaenoptera musculus (blue whale): 118885004 Help Entry 118885004         CDS       T09887                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04010   MAPK signaling pathway bmus04014   Ras signaling pathway bmus04015   Rap1 signaling pathway bmus04024   cAMP signaling pathway bmus04072   Phospholipase D signaling pathway bmus04137   Mitophagy - animal bmus04140   Autophagy - animal bmus04218   Cellular senescence bmus04360   Axon guidance bmus04371   Apelin signaling pathway bmus04625   C-type lectin receptor signaling pathway bmus04810   Regulation of actin cytoskeleton bmus05132   Salmonella infection bmus05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:bmus00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118885004 (RRAS)    04014 Ras signaling pathway     118885004 (RRAS)    04015 Rap1 signaling pathway     118885004 (RRAS)    04371 Apelin signaling pathway     118885004 (RRAS)    04072 Phospholipase D signaling pathway     118885004 (RRAS)    04024 cAMP signaling pathway     118885004 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118885004 (RRAS)    04137 Mitophagy - animal     118885004 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     118885004 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     118885004 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118885004 (RRAS)   09158 Development and regeneration    04360 Axon guidance     118885004 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     118885004 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     118885004 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:bmus04031]     118885004 (RRAS) GTP-binding proteins [BR:bmus04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     118885004 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  118885004 NCBI-ProteinID:  XP_036689154 UniProt:  A0A8C0E0Q8 LinkDB All DBs Position 19:7463607..7467623 Genome browser AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICMVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPIVLVGNKADLETQRQVPRSEASTFSASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPCPPSAPRKKDGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcggggggccgggg cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgacccc actattgaagactcctacacgaagatctgcatggtggatggcgtcccagcccgcctagac atcctggacaccgccggccaggaggagttcggtgctatgcgggagcagtacatgcgcgcc ggccacggcttcctgctggtgtttgccattaacgaccggcagagtttcaacgaggtgggc aagctcttcacgcagatcctccgagtcaaggaccgagatgacttccccatcgtgttggtc gggaacaaggcagatctggagacacagcgccaggttccccgatccgaagcctccaccttc agcgcctcccaccacgtggcctactttgaggcctcggccaaactgcgcctcaatgtggac gaggccttcgagcagctggtgcgggctgtccggaagtaccaggaacaagagctcccgccc tgcccgcccagcgcccccaggaagaaggacgggggttgcccctgcgtcctcctgtag

DBGET integrated database retrieval system