Balaenoptera musculus (blue whale): 118885832 Help Entry 118885832         CDS       T09887                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04621   NOD-like receptor signaling pathway bmus05012   Parkinson disease bmus05132   Salmonella infection bmus05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bmus00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     118885832  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118885832   09164 Neurodegenerative disease    05012 Parkinson disease     118885832   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     118885832  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bmus03110]     118885832 Chaperones and folding catalysts [BR:bmus03110]  Protein folding catalysts   Protein disulfide isomerase    118885832 SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 DIM1 Thioredoxin_8 A6-like_Thioredoxin-like_C Thioredoxin_9 Thioredoxin_7 OST3_OST6 AhpC-TSA Redoxin Motif Other DBs NCBI-GeneID:  118885832 NCBI-ProteinID:  XP_036690842 UniProt:  A0A8B8W1A2 LinkDB All DBs Position 19 Genome browser AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKINKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagattgagagcaagtatgcttttcaggaagccttgaacagtgcaggagag aaactcgtagtagtcgacttctcagccacgtggtgtgggccttgcaaaataaacaagcct ttctttcattctctctctgaaaagtattccaacgtagtgttcctcgaagtagatgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaagggacagaaggtgggtgaattttctggagctaataaggaaaaacttgaagccacc attaatgaattaatctaa

DBGET integrated database retrieval system