Balaenoptera musculus (blue whale): 118886715 Help Entry 118886715         CDS       T09887                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04015   Rap1 signaling pathway bmus04810   Regulation of actin cytoskeleton bmus05014   Amyotrophic lateral sclerosis bmus05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bmus00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     118886715 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     118886715 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118886715 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     118886715 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bmus04131]     118886715 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bmus04812]     118886715 (PFN1)    04147 Exosome [BR:bmus04147]     118886715 (PFN1) Membrane trafficking [BR:bmus04131]  Others   Actin-binding proteins    Others     118886715 (PFN1) Cytoskeleton proteins [BR:bmus04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      118886715 (PFN1) Exosome [BR:bmus04147]  Exosomal proteins   Proteins found in most exosomes    118886715 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  118886715 NCBI-ProteinID:  XP_036692713 UniProt:  A0A8C0DZH1 LinkDB All DBs Position 20:49993807..49996691 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIENLMADGMCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGTLVGKDRSSFF VNGLTLGGQKCSVIRDSMMQEGDFTMDLRTKSSCGAPTFNITVTLTTKTLVLLMGKEGIH GGTINKKCHEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggctggaacgcctacatcgaaaacctcatggcggacgggatgtgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaagaccttc gtcaacatcacgccagctgaggttggtaccctggttggcaaagaccggtcaagttttttc gtgaatgggctaacgcttgggggccagaaatgttctgtgatccgggactcaatgatgcag gaaggggactttaccatggatcttcgtaccaagagcagctgcggagcccccaccttcaat atcactgtcaccctgactaccaagacgctagtcctgctgatgggcaaagaaggtatccac ggtggtacgatcaacaagaaatgtcatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system