Balaenoptera musculus (blue whale): 118886751 Help Entry 118886751         CDS       T09887                                  Symbol CRK Name (RefSeq) adapter molecule crk isoform X1   KO K04438   C-crk adapter molecule crk Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04010   MAPK signaling pathway bmus04012   ErbB signaling pathway bmus04015   Rap1 signaling pathway bmus04062   Chemokine signaling pathway bmus04148   Efferocytosis bmus04510   Focal adhesion bmus04666   Fc gamma R-mediated phagocytosis bmus04722   Neurotrophin signaling pathway bmus04810   Regulation of actin cytoskeleton bmus04910   Insulin signaling pathway bmus04935   Growth hormone synthesis, secretion and action bmus05100   Bacterial invasion of epithelial cells bmus05135   Yersinia infection bmus05163   Human cytomegalovirus infection bmus05170   Human immunodeficiency virus 1 infection bmus05200   Pathways in cancer bmus05206   MicroRNAs in cancer bmus05211   Renal cell carcinoma bmus05220   Chronic myeloid leukemia Brite KEGG Orthology (KO) [BR:bmus00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118886751 (CRK)    04012 ErbB signaling pathway     118886751 (CRK)    04015 Rap1 signaling pathway     118886751 (CRK)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     118886751 (CRK)   09144 Cellular community - eukaryotes    04510 Focal adhesion     118886751 (CRK)   09142 Cell motility    04810 Regulation of actin cytoskeleton     118886751 (CRK)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     118886751 (CRK)    04062 Chemokine signaling pathway     118886751 (CRK)   09152 Endocrine system    04910 Insulin signaling pathway     118886751 (CRK)    04935 Growth hormone synthesis, secretion and action     118886751 (CRK)   09156 Nervous system    04722 Neurotrophin signaling pathway     118886751 (CRK)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118886751 (CRK)    05206 MicroRNAs in cancer     118886751 (CRK)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     118886751 (CRK)    05211 Renal cell carcinoma     118886751 (CRK)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     118886751 (CRK)    05163 Human cytomegalovirus infection     118886751 (CRK)   09171 Infectious disease: bacterial    05135 Yersinia infection     118886751 (CRK)    05100 Bacterial invasion of epithelial cells     118886751 (CRK) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804 Motif Other DBs NCBI-GeneID:  118886751 NCBI-ProteinID:  XP_036692812 UniProt:  A0A8B8W6S7 LinkDB All DBs Position 20:complement(46310299..46336735) Genome browser AA seq 304 aa AA seqDB search MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD EDFS NT seq 915 nt NT seq  +upstreamnt  +downstreamnt atggcgggcaacttcgactcggaggagcggagtagctggtactgggggcggctgagtcgg caggaggcggtggcgctgttgcagggccagcggcacggggtgttcctggtgcgggactcg agcaccagccccggggactatgtgctcagcgtctccgagaactcgcgcgtctcccactac atcatcaacagcagcggcccgcgcccgccggtgccaccgtcgcccgcccagcctccgccc ggggtgagcccctccagactccgaataggagatcaagaatttgattcattgcctgcttta ctggaattctacaaaatacactatttggacactacaacattgatagaaccagtttccaga tccaggcagggtagtggagtgattctcaggcaggaggaggcagagtatgtacgagccctc tttgactttaatgggaatgatgaagaagatcttccctttaagaaaggagacatcctgaga atccgggataagcctgaagagcagtggtggaatgcggaggacagcgaaggcaagaggggg atgattccagtcccttacgtcgagaagtatagacctgcctccgcctcagtatcggctctg attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcccgggccc tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatttatgcc agggtaatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcctgat gaggacttcagctga

DBGET integrated database retrieval system