Balaenoptera musculus (blue whale): 118886923 Help Entry 118886923         CDS       T09887                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04613   Neutrophil extracellular trap formation bmus05034   Alcoholism bmus05202   Transcriptional misregulation in cancer bmus05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bmus00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     118886923  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     118886923   09163 Immune disease    05322 Systemic lupus erythematosus     118886923   09165 Substance dependence    05034 Alcoholism     118886923  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmus03036]     118886923   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bmus04147]     118886923 Chromosome and associated proteins [BR:bmus03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118886923 Exosome [BR:bmus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118886923 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  118886923 NCBI-ProteinID:  XP_036693193 UniProt:  A0A8B8W7V8 LinkDB All DBs Position 20:17389204..17390517 Genome browser AA seq 145 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGESLSEGSFYGVL NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagactgctcgtaagtccacgggtggcaaagcgccccgcaaacag ctggccactaaagcggccaggaaaagcgctccctctaccggcggggtgaaaaaacctcat cgctacaggcccgggaccgttgcgcttcgagaaatccgtcgttaccagaaatccacggag cttctgatccggaagctgcctttccagaggttggtgagggagatcgcccaggatttcaaa accgacttgaggttccagagtgccgccattggtgcgcttcaggaggctagtgaagcgtac ctggtgggtttgtttgaagatactaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccagttggctcgccggatacggggagagagcttaagtgaaggcagt ttttatggtgttttgtag

DBGET integrated database retrieval system