Balaenoptera musculus (blue whale): 118886997 Help Entry 118886997         CDS       T09887                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04014   Ras signaling pathway bmus04137   Mitophagy - animal bmus04144   Endocytosis bmus04145   Phagosome bmus04148   Efferocytosis bmus04962   Vasopressin-regulated water reabsorption bmus05132   Salmonella infection bmus05146   Amoebiasis bmus05152   Tuberculosis Brite KEGG Orthology (KO) [BR:bmus00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     118886997 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118886997 (RAB5C)    04145 Phagosome     118886997 (RAB5C)    04137 Mitophagy - animal     118886997 (RAB5C)    04148 Efferocytosis     118886997 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     118886997 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118886997 (RAB5C)    05152 Tuberculosis     118886997 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     118886997 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bmus04131]     118886997 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bmus04147]     118886997 (RAB5C)    04031 GTP-binding proteins [BR:bmus04031]     118886997 (RAB5C) Membrane trafficking [BR:bmus04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     118886997 (RAB5C)  Endosome - Lysosome transport     118886997 (RAB5C) Exosome [BR:bmus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118886997 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    118886997 (RAB5C)   Exosomal proteins of colorectal cancer cells    118886997 (RAB5C)   Exosomal proteins of bladder cancer cells    118886997 (RAB5C) GTP-binding proteins [BR:bmus04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     118886997 (RAB5C) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  118886997 NCBI-ProteinID:  XP_036693367 UniProt:  A0A8C0DTY3 LinkDB All DBs Position 20:complement(20829022..20851225) Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYAEDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNTACAPGRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggtgctgcacgacccaacggaccagctgctgggaacaagatctgt cagtttaagctggtcctgctgggggagtccgcagtgggcaaatccagcctcgtcctccgc tttgtcaagggtcaattccacgagtaccaggagagcacaattggagcggccttcctcaca cagaccgtctgcttggacgacacaacagtcaagtttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc tacgacatcaccaacacagatacgtttgcacgggccaagaactgggtgaaggagttgcag aggcaggccagccccaacatcgtcatcgcgctcgcaggcaacaaggccgacctggccagc aagagggccgtggagttccaggaagcacaagcctatgcagaggacaacagtttgctgttt atggagacatcagcaaagactgcgatgaacgtgaatgaaattttcatggcaatagctaag aagcttcccaagaacgagccccagaatacagcttgtgctccgggccggaaccgaggagtg gacctccaggagaacaaccctgccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system