Balaenoptera musculus (blue whale): 118890933
Help
Entry
118890933 CDS
T09887
Symbol
SLC22A17
Name
(RefSeq) solute carrier family 22 member 17 isoform X1
KO
K08213
MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 17
Organism
bmus
Balaenoptera musculus (blue whale)
Brite
KEGG Orthology (KO) [BR:
bmus00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
bmus02000
]
118890933 (SLC22A17)
Transporters [BR:
bmus02000
]
Solute carrier family (SLC)
SLC22: Organic cation/anion/zwitterion transporter
118890933 (SLC22A17)
Major facilitator superfamily (MFS)
Organic acid transporters
Organic cation transporter (OCT) family [TC:
2.A.1.19
]
118890933 (SLC22A17)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MFS_1
Sugar_tr
TRI12
Motif
Other DBs
NCBI-GeneID:
118890933
NCBI-ProteinID:
XP_036700270
UniProt:
A0A8B8WSR7
LinkDB
All DBs
Position
2:complement(101669010..101675418)
Genome browser
AA seq
585 aa
AA seq
DB search
MGSSLSLAVPPGPLSFEALLAQVGALGGGQQLQLGLCCLPVLFVALGMASDPIFTLAPPL
HCHYGAFAPNASGWEQPPNASGVSVASAALAASAASRIATSTDPSCSGFAPPDFNHCLKD
WDYNGLPVLTTNAIGQWDLVCDLGWQVILEQILFILGFASGYLFLGYPADRFGRRGIVLL
TLGLVGPCGVGGAAAGSSTGVMALRFLLGFLLAGVDLGVYLMRLELCDPTQRLRVALAGE
LVGVGGHFLFLGLALVSKDWRFLQRMITAPCILFLFYGWPGLFLESARWLIVKRQIEEAQ
SVLRILAERNRPHGQMLGEEAQEALQDLENTCPLPATSSFSFASLLNYRNIWKNLLILGF
TNFIAHAIRHCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSMT
LTGIASLVLLGLWDCEHPPFPTVWAQQRNPSRDLNEAAITTFSVLGLFSSQTAGILSTLL
AAEVIPTTVRGRGLGLIMALGALGGLSGPAQRLHMGHGAFLQHVVLAACALLCILSIMLL
PETKRKLLPEVLRDGELCRRPSLLRQPPPNRCDHVPLLATPNPAL
NT seq
1758 nt
NT seq
+upstream
nt +downstream
nt
atgggcagcagcctgtcgctggccgtgccccccggccccctcagcttcgaggcgctgctc
gcccaggtgggggcgctgggcggcggccagcagctgcagctcggcctctgctgcctgccc
gtgctctttgtggcgctgggcatggcctcggaccccatcttcacgctggcgcccccgctg
cattgccactacggggccttcgcccccaacgcctctggctgggagcagccccccaacgcc
agcggcgtcagcgtcgccagcgccgccctagcagccagcgccgccagccgcatcgccacc
agtacggacccctcgtgcagtggcttcgccccgccggacttcaaccactgcctcaaggac
tgggactataacggcctccccgtgctcaccaccaacgccatcggccagtgggatctggtg
tgtgacctgggctggcaggtgatcctggagcagatcctcttcatcttgggctttgcctct
ggctacctgttcctgggctacccggcagacaggtttggccgtcgtgggattgtgttgctg
accttgggactggtgggcccctgtggagtgggaggggctgctgcaggctcttccacaggt
gtcatggccctccgattcctcctgggctttctgcttgccggcgttgaccttggtgtctac
ctgatgcgcctggagctgtgcgacccaacccagaggcttcgggtggccctggcaggggag
ttggtgggggtaggggggcacttcctgttcctgggcctggcccttgtctctaaggactgg
cgatttctgcagcgaatgatcaccgctccctgcatcctcttcctgttttatggatggcct
ggtctgtttctggagtccgcacggtggctgatagtgaagcgacagattgaggaggcccag
tctgtgctgaggatactggctgagcggaaccggccccatgggcagatgctgggagaggag
gcccaggaggccctgcaggacctggagaacacctgccctctccctgcaacatcctccttt
tccttcgcttccctcctcaactaccgcaacatctggaaaaatctacttatcctgggattc
accaactttattgcccacgccattcgccactgctaccagcctgtgggaggaggagggagc
ccatcggacttctacctgtgctccttgctggccagcggcacagctgccctggcctgcgtc
ttcctgggggtcaccgtggaccgatttggccgccggggcatcctgcttctctcgatgacc
ctcactggcattgcgtccctggtcctgctgggcctgtgggattgtgagcatcctcccttc
cccacggtgtgggctcagcaaaggaaccccagcagagatctgaacgaggccgccatcacc
accttctccgtccttggcctcttctcctcccaaactgctggcatcctcagcaccctcctt
gctgctgaagtcatccctaccactgtccggggccgaggcctgggcctgatcatggcactg
ggggcacttggcgggctgagtggcccagcccagcgcctccacatgggccatggagctttc
ctgcagcacgtggtgctggcggcctgtgctctcctctgcatcctcagcatcatgcttctg
ccggagaccaaacgcaagcttctgcccgaggtgctccgggatggggagctgtgccgccgg
ccttccctgctgcggcagccaccccctaaccgctgtgaccacgttccactgcttgccacc
cccaaccctgccctctga
DBGET
integrated database retrieval system