Balaenoptera musculus (blue whale): 118891010 Help Entry 118891010         CDS       T09887                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04024   cAMP signaling pathway bmus04062   Chemokine signaling pathway bmus04064   NF-kappa B signaling pathway bmus04210   Apoptosis bmus04380   Osteoclast differentiation bmus04519   Cadherin signaling bmus04620   Toll-like receptor signaling pathway bmus04621   NOD-like receptor signaling pathway bmus04622   RIG-I-like receptor signaling pathway bmus04623   Cytosolic DNA-sensing pathway bmus04625   C-type lectin receptor signaling pathway bmus04657   IL-17 signaling pathway bmus04658   Th1 and Th2 cell differentiation bmus04659   Th17 cell differentiation bmus04660   T cell receptor signaling pathway bmus04662   B cell receptor signaling pathway bmus04668   TNF signaling pathway bmus04722   Neurotrophin signaling pathway bmus04920   Adipocytokine signaling pathway bmus04926   Relaxin signaling pathway bmus04931   Insulin resistance bmus04936   Alcoholic liver disease bmus05132   Salmonella infection bmus05134   Legionellosis bmus05135   Yersinia infection bmus05140   Leishmaniasis bmus05142   Chagas disease bmus05145   Toxoplasmosis bmus05160   Hepatitis C bmus05161   Hepatitis B bmus05162   Measles bmus05163   Human cytomegalovirus infection bmus05164   Influenza A bmus05166   Human T-cell leukemia virus 1 infection bmus05167   Kaposi sarcoma-associated herpesvirus infection bmus05168   Herpes simplex virus 1 infection bmus05169   Epstein-Barr virus infection bmus05170   Human immunodeficiency virus 1 infection bmus05171   Coronavirus disease bmus05200   Pathways in cancer bmus05203   Viral carcinogenesis bmus05208   Chemical carcinogenesis - reactive oxygen species bmus05215   Prostate cancer bmus05220   Chronic myeloid leukemia bmus05222   Small cell lung cancer bmus05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bmus05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bmus00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     118891010 (NFKBIA)    04668 TNF signaling pathway     118891010 (NFKBIA)    04024 cAMP signaling pathway     118891010 (NFKBIA)   09133 Signaling molecules and interaction    04519 Cadherin signaling     118891010 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     118891010 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118891010 (NFKBIA)    04621 NOD-like receptor signaling pathway     118891010 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     118891010 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     118891010 (NFKBIA)    04625 C-type lectin receptor signaling pathway     118891010 (NFKBIA)    04660 T cell receptor signaling pathway     118891010 (NFKBIA)    04658 Th1 and Th2 cell differentiation     118891010 (NFKBIA)    04659 Th17 cell differentiation     118891010 (NFKBIA)    04657 IL-17 signaling pathway     118891010 (NFKBIA)    04662 B cell receptor signaling pathway     118891010 (NFKBIA)    04062 Chemokine signaling pathway     118891010 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     118891010 (NFKBIA)    04926 Relaxin signaling pathway     118891010 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     118891010 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     118891010 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118891010 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     118891010 (NFKBIA)    05203 Viral carcinogenesis     118891010 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     118891010 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     118891010 (NFKBIA)    05215 Prostate cancer     118891010 (NFKBIA)    05222 Small cell lung cancer     118891010 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     118891010 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     118891010 (NFKBIA)    05161 Hepatitis B     118891010 (NFKBIA)    05160 Hepatitis C     118891010 (NFKBIA)    05171 Coronavirus disease     118891010 (NFKBIA)    05164 Influenza A     118891010 (NFKBIA)    05162 Measles     118891010 (NFKBIA)    05168 Herpes simplex virus 1 infection     118891010 (NFKBIA)    05163 Human cytomegalovirus infection     118891010 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     118891010 (NFKBIA)    05169 Epstein-Barr virus infection     118891010 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     118891010 (NFKBIA)    05135 Yersinia infection     118891010 (NFKBIA)    05134 Legionellosis     118891010 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     118891010 (NFKBIA)    05140 Leishmaniasis     118891010 (NFKBIA)    05142 Chagas disease     118891010 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118891010 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     118891010 (NFKBIA)    04931 Insulin resistance     118891010 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bmus03000]     118891010 (NFKBIA)    04131 Membrane trafficking [BR:bmus04131]     118891010 (NFKBIA) Transcription factors [BR:bmus03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     118891010 (NFKBIA) Membrane trafficking [BR:bmus04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     118891010 (NFKBIA) SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  118891010 NCBI-ProteinID:  XP_036700426 UniProt:  A0A8B8WT67 LinkDB All DBs Position 2 Genome browser AA seq 314 aa AA seqDB search MFQPAEPGQEWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKVLTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAGALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSVLQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcccgcggagcccggccaggagtgggccatggagggcccccgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaagagctgcgggagatccgcctcgagcctcaggaggcgccg cgcggcgccgagccttggaagcagcagctcaccgaggacggagactcattcctgcacttg gccatcatccatgaagagaaggtgctgaccatggaagtggtccgccaagtgaagggagac ctggcgtttctcaacttccagaacaacctgcagcagactcctctccacttggcggtgatc accaaccagccagaaatcgctggggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg ggagtcctgactcagccccgcgggacccagcacctccactccgtcctgcaagccaccaac tacaatggtcacacgtgtctgcacttggcctctattcatggctacctgggcatcgtggag ctgttggtgtccttgggtgctgatgtcaacgcacaggagccctgcaatggccgaactgcc ctccatctcgcggttgacctgcagaatcccgacctggtgtcgctcttgttgaagtgtggg gccgacgtcaacagggtcacctaccagggctactccccgtaccagctcacctggggccgc ccaagcacccggatacagcagcagctgggccagctgaccctagagaaccttcagatgctg cccgagagcgaggatgaggagagctatgacacggagtcagagttcacagaggatgagctg ccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system