Balaenoptera musculus (blue whale): 118892044 Help Entry 118892044         CDS       T09887                                  Name (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus01521   EGFR tyrosine kinase inhibitor resistance bmus01522   Endocrine resistance bmus04010   MAPK signaling pathway bmus04012   ErbB signaling pathway bmus04014   Ras signaling pathway bmus04015   Rap1 signaling pathway bmus04062   Chemokine signaling pathway bmus04068   FoxO signaling pathway bmus04071   Sphingolipid signaling pathway bmus04072   Phospholipase D signaling pathway bmus04137   Mitophagy - animal bmus04140   Autophagy - animal bmus04144   Endocytosis bmus04150   mTOR signaling pathway bmus04151   PI3K-Akt signaling pathway bmus04210   Apoptosis bmus04211   Longevity regulating pathway bmus04213   Longevity regulating pathway - multiple species bmus04218   Cellular senescence bmus04360   Axon guidance bmus04370   VEGF signaling pathway bmus04371   Apelin signaling pathway bmus04510   Focal adhesion bmus04540   Gap junction bmus04550   Signaling pathways regulating pluripotency of stem cells bmus04625   C-type lectin receptor signaling pathway bmus04630   JAK-STAT signaling pathway bmus04650   Natural killer cell mediated cytotoxicity bmus04660   T cell receptor signaling pathway bmus04662   B cell receptor signaling pathway bmus04664   Fc epsilon RI signaling pathway bmus04714   Thermogenesis bmus04720   Long-term potentiation bmus04722   Neurotrophin signaling pathway bmus04725   Cholinergic synapse bmus04726   Serotonergic synapse bmus04730   Long-term depression bmus04810   Regulation of actin cytoskeleton bmus04910   Insulin signaling pathway bmus04912   GnRH signaling pathway bmus04915   Estrogen signaling pathway bmus04916   Melanogenesis bmus04917   Prolactin signaling pathway bmus04919   Thyroid hormone signaling pathway bmus04921   Oxytocin signaling pathway bmus04926   Relaxin signaling pathway bmus04929   GnRH secretion bmus04933   AGE-RAGE signaling pathway in diabetic complications bmus04935   Growth hormone synthesis, secretion and action bmus05010   Alzheimer disease bmus05022   Pathways of neurodegeneration - multiple diseases bmus05034   Alcoholism bmus05132   Salmonella infection bmus05160   Hepatitis C bmus05161   Hepatitis B bmus05163   Human cytomegalovirus infection bmus05165   Human papillomavirus infection bmus05166   Human T-cell leukemia virus 1 infection bmus05167   Kaposi sarcoma-associated herpesvirus infection bmus05170   Human immunodeficiency virus 1 infection bmus05200   Pathways in cancer bmus05203   Viral carcinogenesis bmus05205   Proteoglycans in cancer bmus05206   MicroRNAs in cancer bmus05207   Chemical carcinogenesis - receptor activation bmus05208   Chemical carcinogenesis - reactive oxygen species bmus05210   Colorectal cancer bmus05211   Renal cell carcinoma bmus05213   Endometrial cancer bmus05214   Glioma bmus05215   Prostate cancer bmus05216   Thyroid cancer bmus05218   Melanoma bmus05219   Bladder cancer bmus05220   Chronic myeloid leukemia bmus05221   Acute myeloid leukemia bmus05223   Non-small cell lung cancer bmus05224   Breast cancer bmus05225   Hepatocellular carcinoma bmus05226   Gastric cancer bmus05230   Central carbon metabolism in cancer bmus05231   Choline metabolism in cancer bmus05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bmus05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bmus00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118892044    04012 ErbB signaling pathway     118892044    04014 Ras signaling pathway     118892044    04015 Rap1 signaling pathway     118892044    04370 VEGF signaling pathway     118892044    04371 Apelin signaling pathway     118892044    04630 JAK-STAT signaling pathway     118892044    04068 FoxO signaling pathway     118892044    04072 Phospholipase D signaling pathway     118892044    04071 Sphingolipid signaling pathway     118892044    04151 PI3K-Akt signaling pathway     118892044    04150 mTOR signaling pathway     118892044  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118892044    04140 Autophagy - animal     118892044    04137 Mitophagy - animal     118892044   09143 Cell growth and death    04210 Apoptosis     118892044    04218 Cellular senescence     118892044   09144 Cellular community - eukaryotes    04510 Focal adhesion     118892044    04540 Gap junction     118892044    04550 Signaling pathways regulating pluripotency of stem cells     118892044   09142 Cell motility    04810 Regulation of actin cytoskeleton     118892044  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118892044    04650 Natural killer cell mediated cytotoxicity     118892044    04660 T cell receptor signaling pathway     118892044    04662 B cell receptor signaling pathway     118892044    04664 Fc epsilon RI signaling pathway     118892044    04062 Chemokine signaling pathway     118892044   09152 Endocrine system    04910 Insulin signaling pathway     118892044    04929 GnRH secretion     118892044    04912 GnRH signaling pathway     118892044    04915 Estrogen signaling pathway     118892044    04917 Prolactin signaling pathway     118892044    04921 Oxytocin signaling pathway     118892044    04926 Relaxin signaling pathway     118892044    04935 Growth hormone synthesis, secretion and action     118892044    04919 Thyroid hormone signaling pathway     118892044    04916 Melanogenesis     118892044   09156 Nervous system    04725 Cholinergic synapse     118892044    04726 Serotonergic synapse     118892044    04720 Long-term potentiation     118892044    04730 Long-term depression     118892044    04722 Neurotrophin signaling pathway     118892044   09158 Development and regeneration    04360 Axon guidance     118892044   09149 Aging    04211 Longevity regulating pathway     118892044    04213 Longevity regulating pathway - multiple species     118892044   09159 Environmental adaptation    04714 Thermogenesis     118892044  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118892044    05206 MicroRNAs in cancer     118892044    05205 Proteoglycans in cancer     118892044    05207 Chemical carcinogenesis - receptor activation     118892044    05208 Chemical carcinogenesis - reactive oxygen species     118892044    05203 Viral carcinogenesis     118892044    05230 Central carbon metabolism in cancer     118892044    05231 Choline metabolism in cancer     118892044    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     118892044   09162 Cancer: specific types    05210 Colorectal cancer     118892044    05225 Hepatocellular carcinoma     118892044    05226 Gastric cancer     118892044    05214 Glioma     118892044    05216 Thyroid cancer     118892044    05221 Acute myeloid leukemia     118892044    05220 Chronic myeloid leukemia     118892044    05218 Melanoma     118892044    05211 Renal cell carcinoma     118892044    05219 Bladder cancer     118892044    05215 Prostate cancer     118892044    05213 Endometrial cancer     118892044    05224 Breast cancer     118892044    05223 Non-small cell lung cancer     118892044   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     118892044    05170 Human immunodeficiency virus 1 infection     118892044    05161 Hepatitis B     118892044    05160 Hepatitis C     118892044    05163 Human cytomegalovirus infection     118892044    05167 Kaposi sarcoma-associated herpesvirus infection     118892044    05165 Human papillomavirus infection     118892044   09171 Infectious disease: bacterial    05132 Salmonella infection     118892044   09164 Neurodegenerative disease    05010 Alzheimer disease     118892044    05022 Pathways of neurodegeneration - multiple diseases     118892044   09165 Substance dependence    05034 Alcoholism     118892044   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118892044   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     118892044   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     118892044    01522 Endocrine resistance     118892044  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bmus04131]     118892044   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bmus04147]     118892044    04031 GTP-binding proteins [BR:bmus04031]     118892044 Membrane trafficking [BR:bmus04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     118892044  Endocytosis   Macropinocytosis    Ras GTPases     118892044 Exosome [BR:bmus04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    118892044   Exosomal proteins of colorectal cancer cells    118892044 GTP-binding proteins [BR:bmus04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     118892044 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc MMR_HSR1 AAA_14 Motif Other DBs NCBI-GeneID:  118892044 NCBI-ProteinID:  XP_036701969 UniProt:  A0A8B8WXE5 LinkDB All DBs Position 3:complement(163572223..163616456) Genome browser AA seq 244 aa AA seqDB search MTECKLTVVGARGVGKSALTIQLTQSHFVDEYHPTVEDSHRKQVVIDGETCLPGILDTVG QEEYSAMRAQHMRTREGFLCLPSTTPSLSRTRSFEDIRQYREQIEWVKESDDMPRVLLGN KCDLATCSVECRQAQDLARSYGVLYMETSAKKCQGVEDAFYKLEFKSRQHKASKLSPPAR RGRPGLPELQVPALLTEAQATGVEEAQAGKMQGRKEVPPPEPSQPRWMCLEDNVSLRTRE TSRC NT seq 735 nt NT seq  +upstreamnt  +downstreamnt atgacggagtgtaagctcacggtggtgggtgccagaggcgtggggaagagtgccctgacc atccagctcacccagagccactttgtggatgagtaccatcccaccgtagaggactcccac cggaagcaagtggtcatcgatggggagacgtgcctgccgggcatcctggacacggtgggc caggaggagtacagtgccatgcgggcccagcacatgcgcacccgggagggcttcctctgt ttgccgtcaacgacgccaagtctttcaaggaccagatcctttgaggacatccgccagtac agggagcagatcgagtgggtgaaggaatcagacgacatgcccagggtgctgttggggaac aagtgtgacctggccacttgttccgtggagtgtcggcaggcccaggacctggcccgcagc tatggcgtcctgtacatggagacttcggccaagaagtgccagggcgtggaggatgccttc tacaagctggagttcaagagccggcagcacaaggcgagcaagctgagcccgcccgcccga cgggggcggcctgggctgcctgagctgcaggtgcctgctctcctgactgaggcacaggcg acaggcgtggaagaggcacaagcagggaagatgcagggcaggaaggaagtgccgccgccg gagcccagccagcccagatggatgtgtctggaggataatgtatccctgaggacaagagaa acttctcgatgttaa

DBGET integrated database retrieval system