Balaenoptera musculus (blue whale): 118892351 Help Entry 118892351         CDS       T09887                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04068   FoxO signaling pathway bmus04136   Autophagy - other bmus04140   Autophagy - animal bmus04621   NOD-like receptor signaling pathway bmus04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:bmus00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     118892351 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118892351 (ATG12)    04136 Autophagy - other     118892351 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     118892351 (ATG12)    04622 RIG-I-like receptor signaling pathway     118892351 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bmus04131]     118892351 (ATG12)    04121 Ubiquitin system [BR:bmus04121]     118892351 (ATG12)    03029 Mitochondrial biogenesis [BR:bmus03029]     118892351 (ATG12) Membrane trafficking [BR:bmus04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     118892351 (ATG12) Ubiquitin system [BR:bmus04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    118892351 (ATG12) Mitochondrial biogenesis [BR:bmus03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     118892351 (ATG12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  118892351 NCBI-ProteinID:  XP_036702829 UniProt:  A0A8B8WZV3 LinkDB All DBs Position 3:complement(93833758..93859821) Genome browser AA seq 140 aa AA seqDB search MAEEPESALQLPPSIAAEGEGPTEVSPETATPEPPSSAAVSPGTEEPAGDTKKKIDILLK AVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLY ECFGSDGKLVLHYCKSQAWG NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggctgaggagccggagtctgcgctgcagctccctccctcaattgctgctgaaggtgaa ggacccacggaggtctccccagaaacagccactccggagcccccatcttccgctgcagtc tctccgggaacagaggaacctgccggtgacaccaagaagaaaattgacatcctgctaaag gctgtgggagacactcctataatgaaaacaaagaaatgggctgtagagcgaacccgaacc atccaaggactcattgacttcatcaaaaagttccttaaactggtggcttcagaacagttg tttatttatgtgaatcagtcctttgccccctccccagaccaggaagttggaaccctctat gagtgttttggcagtgatggtaaactggtcctgcattactgcaaatctcaggcatgggga tga

DBGET integrated database retrieval system