Balaenoptera musculus (blue whale): 118893370 Help Entry 118893370         CDS       T09887                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04015   Rap1 signaling pathway bmus04810   Regulation of actin cytoskeleton bmus05014   Amyotrophic lateral sclerosis bmus05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bmus00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     118893370 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     118893370 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118893370 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     118893370 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bmus04131]     118893370 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bmus04812]     118893370 (PFN3)    04147 Exosome [BR:bmus04147]     118893370 (PFN3) Membrane trafficking [BR:bmus04131]  Others   Actin-binding proteins    Others     118893370 (PFN3) Cytoskeleton proteins [BR:bmus04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      118893370 (PFN3) Exosome [BR:bmus04147]  Exosomal proteins   Proteins found in most exosomes    118893370 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  118893370 NCBI-ProteinID:  XP_036704749 UniProt:  A0A8B8X5A2 LinkDB All DBs Position 3:complement(150663597..150664140) Genome browser AA seq 137 aa AA seqDB search MGEWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFL QAGLSVAGRRCCVIRDHLLAKGDGVLDGRTKGLDGRAICVGHTPRVLLVLMGRRGVHGGI LNKKMHELIHGLRSQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgagtggaaaggctacatcagtgcggtgctgcgggaccagcgcatcgacgacgtg gccatcgtgggccactcggacaatcgctgcgtgtgggcatcgcggcccggtggcctgctg gcggccatctcaccgcaggaggtgggtgtactcacggggccggaccggcgcaccttcctg caggcgggcctgagcgtggcgggccgccgctgctgcgtcatccgagaccacctgctggcc aagggagacggagtgctggacgggcgcactaaggggctggacgggcgcgccatctgcgtg ggccacacgccgcgtgtgctcctcgtgctcatgggccggcggggcgtgcatgggggcatt ctcaacaagaagatgcacgagctgatccacgggctgcgctcgcagggcacctag

DBGET integrated database retrieval system