Balaenoptera musculus (blue whale): 118894315 Help Entry 118894315         CDS       T09887                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04014   Ras signaling pathway bmus04137   Mitophagy - animal bmus04144   Endocytosis bmus04145   Phagosome bmus04148   Efferocytosis bmus04962   Vasopressin-regulated water reabsorption bmus05014   Amyotrophic lateral sclerosis bmus05022   Pathways of neurodegeneration - multiple diseases bmus05132   Salmonella infection bmus05146   Amoebiasis bmus05152   Tuberculosis Brite KEGG Orthology (KO) [BR:bmus00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     118894315 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118894315 (RAB5A)    04145 Phagosome     118894315 (RAB5A)    04137 Mitophagy - animal     118894315 (RAB5A)    04148 Efferocytosis     118894315 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     118894315 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118894315 (RAB5A)    05152 Tuberculosis     118894315 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     118894315 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     118894315 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     118894315 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bmus04131]     118894315 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bmus04147]     118894315 (RAB5A)    04031 GTP-binding proteins [BR:bmus04031]     118894315 (RAB5A) Membrane trafficking [BR:bmus04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     118894315 (RAB5A)  Endosome - Lysosome transport     118894315 (RAB5A) Exosome [BR:bmus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118894315 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    118894315 (RAB5A)   Exosomal proteins of colorectal cancer cells    118894315 (RAB5A)   Exosomal proteins of bladder cancer cells    118894315 (RAB5A) GTP-binding proteins [BR:bmus04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     118894315 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  118894315 NCBI-ProteinID:  XP_036706330 UniProt:  A0A8B8XEI4 LinkDB All DBs Position 4:complement(6855931..6886667) Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaatgggccaaatactggaaataaaatatgccag ttcaaattagtacttctgggagagtctgctgttggcaaatcgagcctggtgcttcgtttt gtgaagggccaatttcatgaatttcaagagagtaccattggggctgcttttctaacccaa acggtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatac gatatcacaaacgaggagtcctttgccagagccaaaaactgggttaaagagcttcagagg caggccagccctaacattgttatagctttgtcaggaaacaaggctgacctcgcaaataaa agagctgtcgatttccaggaagcacagtcctatgcagatgacaacagtttattatttatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccgaagaatgaaccacagaatccaggagcaaattctgccagaggaagaggagtagac cttactgaacccacgcagccaaccaggagtcagtgctgtagtaactaa

DBGET integrated database retrieval system