Balaenoptera musculus (blue whale): 118894554 Help Entry 118894554         CDS       T09887                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04613   Neutrophil extracellular trap formation bmus05034   Alcoholism bmus05202   Transcriptional misregulation in cancer bmus05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bmus00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     118894554  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     118894554   09163 Immune disease    05322 Systemic lupus erythematosus     118894554   09165 Substance dependence    05034 Alcoholism     118894554  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmus03036]     118894554   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bmus04147]     118894554 Chromosome and associated proteins [BR:bmus03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118894554 Exosome [BR:bmus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118894554 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  118894554 NCBI-ProteinID:  XP_036706792 UniProt:  A0A8C0CF65 LinkDB All DBs Position 1:108191843..108192292 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgtacaaagcagactgcccgcaagtcgaccggtggcaaggccccgcggaagcag ctggccaccaaggcggctcgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggccgggcaccgtggccctgcgcgagatccggcgctaccagaagtcgaccgag ctgctgatccgcaagctgcccttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgagcgaggcctac ctggtggggctgtttgaagacacgaacttgtgcgctatccacgccaagcgcgtgaccatc atgcccaaagacatccagctggcccgccgcatccgcggggagcgggcttaa

DBGET integrated database retrieval system