Balaenoptera musculus (blue whale): 118894822 Help Entry 118894822         CDS       T09887                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04613   Neutrophil extracellular trap formation bmus05034   Alcoholism bmus05202   Transcriptional misregulation in cancer bmus05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bmus00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     118894822  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     118894822   09163 Immune disease    05322 Systemic lupus erythematosus     118894822   09165 Substance dependence    05034 Alcoholism     118894822  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmus03036]     118894822   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bmus04147]     118894822 Chromosome and associated proteins [BR:bmus03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118894822 Exosome [BR:bmus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118894822 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone PAF CENP-S CENP-T_C Motif Other DBs NCBI-GeneID:  118894822 NCBI-ProteinID:  XP_036707345 UniProt:  A0A8C0D1I7 LinkDB All DBs Position 4:64627194..64627665 Genome browser AA seq 136 aa AA seqDB search MARTKQTAPKSTGGKAPRKQLATKAARRSAPSTGGMRKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAHLVGLFEDTNLCAIHAKTVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagactgctcctaagtccacaggtggcaaagcgccccgcaaacag ctggccactaaagcggccaggagaagcgccccctctaccggcgggatgagaaaacctcat cgctacaggcccgggaccgttgcgcttcgagaaatacgtcgttaccagaaatccaccgag cttctgatccggaagctgcctttccagaggttggtgagggagatcgcccaggatttcaaa accgacttgaggttccagagtgccgccatcggtgcgcttcaggaggctagtgaagcgcac ctggtgggtttatttgaagatactaatctgtgtgccatccacgcaaagacagtcaccatc atgcccaaagacatccagttggctcgccggatacggggagagagagcttaa

DBGET integrated database retrieval system