Balaenoptera musculus (blue whale): 118895221 Help Entry 118895221         CDS       T09887                                  Name (RefSeq) C-X-C motif chemokine 6-like   KO K05506   C-X-C motif chemokine 5/6 Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04060   Cytokine-cytokine receptor interaction bmus04061   Viral protein interaction with cytokine and cytokine receptor bmus04062   Chemokine signaling pathway bmus04657   IL-17 signaling pathway bmus04668   TNF signaling pathway bmus05133   Pertussis bmus05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:bmus00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     118895221   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118895221    04061 Viral protein interaction with cytokine and cytokine receptor     118895221  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     118895221    04062 Chemokine signaling pathway     118895221  09160 Human Diseases   09171 Infectious disease: bacterial    05133 Pertussis     118895221   09163 Immune disease    05323 Rheumatoid arthritis     118895221  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bmus04052]     118895221 Cytokines and neuropeptides [BR:bmus04052]  Cytokines   Chemokines    118895221 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  118895221 NCBI-ProteinID:  XP_036707968 UniProt:  A0A8B8XE49 LinkDB All DBs Position 5:complement(50114863..50116868) Genome browser AA seq 145 aa AA seqDB search MRRTRRSHGALELQIPPLLPPSEALSLSLFATMRLLPSRAARIPGPSGSLRLLLALLLLT PPGPLASAGPIAAIVRELRCMCLTTTPGIHPKMVSNLQVIAPGPQCSKVEVVATLKNRKE VCLDPEAPLIKKVIQKMLDSGNKKN NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgcggaggacccgaagaagtcacggtgctctagagcttcaaatcccaccccttctccct ccttctgaagccctctcgctgagtctcttcgccactatgagactcctacccagccgcgcc gcccgcatccccggcccttcgggctctctgcgcttgctgctcgcgctgctgctgctgacg ccgccagggcccctcgccagcgctggtcctatcgcggccatagtgagagagctgcgttgc atgtgcttaaccaccacaccggggattcatcccaagatggtcagtaatcttcaggtgatc gccccaggaccgcagtgctccaaggtggaagtagtagccaccttgaagaacagaaaggaa gtctgtctggacccagaagctcctctgatcaagaaggtcatccagaaaatgttggacagt ggaaacaagaaaaattaa

DBGET integrated database retrieval system