Balaenoptera musculus (blue whale): 118895640 Help Entry 118895640         CDS       T09887                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04060   Cytokine-cytokine receptor interaction bmus04061   Viral protein interaction with cytokine and cytokine receptor bmus04062   Chemokine signaling pathway bmus04064   NF-kappa B signaling pathway bmus04072   Phospholipase D signaling pathway bmus04218   Cellular senescence bmus04620   Toll-like receptor signaling pathway bmus04621   NOD-like receptor signaling pathway bmus04622   RIG-I-like receptor signaling pathway bmus04657   IL-17 signaling pathway bmus04932   Non-alcoholic fatty liver disease bmus04933   AGE-RAGE signaling pathway in diabetic complications bmus04936   Alcoholic liver disease bmus05132   Salmonella infection bmus05133   Pertussis bmus05134   Legionellosis bmus05135   Yersinia infection bmus05142   Chagas disease bmus05144   Malaria bmus05146   Amoebiasis bmus05161   Hepatitis B bmus05163   Human cytomegalovirus infection bmus05164   Influenza A bmus05167   Kaposi sarcoma-associated herpesvirus infection bmus05171   Coronavirus disease - COVID-19 bmus05200   Pathways in cancer bmus05202   Transcriptional misregulation in cancer bmus05219   Bladder cancer bmus05323   Rheumatoid arthritis bmus05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bmus00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     118895640 (CXCL8)    04072 Phospholipase D signaling pathway     118895640 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118895640 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     118895640 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     118895640 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118895640 (CXCL8)    04621 NOD-like receptor signaling pathway     118895640 (CXCL8)    04622 RIG-I-like receptor signaling pathway     118895640 (CXCL8)    04657 IL-17 signaling pathway     118895640 (CXCL8)    04062 Chemokine signaling pathway     118895640 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118895640 (CXCL8)    05202 Transcriptional misregulation in cancer     118895640 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     118895640 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     118895640 (CXCL8)    05171 Coronavirus disease - COVID-19     118895640 (CXCL8)    05164 Influenza A     118895640 (CXCL8)    05163 Human cytomegalovirus infection     118895640 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     118895640 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     118895640 (CXCL8)    05135 Yersinia infection     118895640 (CXCL8)    05133 Pertussis     118895640 (CXCL8)    05134 Legionellosis     118895640 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     118895640 (CXCL8)    05144 Malaria     118895640 (CXCL8)    05142 Chagas disease     118895640 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     118895640 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118895640 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     118895640 (CXCL8)    04932 Non-alcoholic fatty liver disease     118895640 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     118895640 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bmus04052]     118895640 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:bmus00536]     118895640 (CXCL8) Cytokines and neuropeptides [BR:bmus04052]  Cytokines   Chemokines    118895640 (CXCL8) Glycosaminoglycan binding proteins [BR:bmus00536]  Heparan sulfate / Heparin   Chemokines    118895640 (CXCL8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  118895640 NCBI-ProteinID:  XP_036708915 UniProt:  A0A8B8XMH9 LinkDB All DBs Position 5:complement(50182749..50185952) Genome browser AA seq 101 aa AA seqDB search MTSKLAIALLAAFLLSAAVCKAAVLARMSSELRCQCINTHSTPFHPKFIKELRVIESGPH CENSEIIVKLGNGKEVCLNPKEKWVQMVVQIFLKRAEKKDP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggctatcgctctcttggcagccttccttctttctgcagctgtgtgt aaagctgcagttctggcaagaatgagttcagaacttcgatgccaatgcataaatacacac tccacacctttccaccccaaatttatcaaagaattgcgagtgattgagagtggaccacac tgtgaaaattcagaaatcattgttaagcttggcaatggaaaagaggtctgcttaaacccc aaggaaaagtgggtgcagatggttgtgcagatatttttgaagagagctgagaagaaagat ccatga

DBGET integrated database retrieval system