Balaenoptera musculus (blue whale): 118896943 Help Entry 118896943         CDS       T09887                                  Name (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04060   Cytokine-cytokine receptor interaction bmus04151   PI3K-Akt signaling pathway bmus04217   Necroptosis bmus04620   Toll-like receptor signaling pathway bmus04621   NOD-like receptor signaling pathway bmus04622   RIG-I-like receptor signaling pathway bmus04623   Cytosolic DNA-sensing pathway bmus04630   JAK-STAT signaling pathway bmus04650   Natural killer cell mediated cytotoxicity bmus04936   Alcoholic liver disease bmus05152   Tuberculosis bmus05160   Hepatitis C bmus05161   Hepatitis B bmus05162   Measles bmus05163   Human cytomegalovirus infection bmus05164   Influenza A bmus05165   Human papillomavirus infection bmus05167   Kaposi sarcoma-associated herpesvirus infection bmus05168   Herpes simplex virus 1 infection bmus05169   Epstein-Barr virus infection bmus05170   Human immunodeficiency virus 1 infection bmus05171   Coronavirus disease - COVID-19 bmus05200   Pathways in cancer bmus05320   Autoimmune thyroid disease bmus05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bmus00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     118896943    04151 PI3K-Akt signaling pathway     118896943   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118896943  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     118896943  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118896943    04621 NOD-like receptor signaling pathway     118896943    04622 RIG-I-like receptor signaling pathway     118896943    04623 Cytosolic DNA-sensing pathway     118896943    04650 Natural killer cell mediated cytotoxicity     118896943  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118896943   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     118896943    05161 Hepatitis B     118896943    05160 Hepatitis C     118896943    05171 Coronavirus disease - COVID-19     118896943    05164 Influenza A     118896943    05162 Measles     118896943    05168 Herpes simplex virus 1 infection     118896943    05163 Human cytomegalovirus infection     118896943    05167 Kaposi sarcoma-associated herpesvirus infection     118896943    05169 Epstein-Barr virus infection     118896943    05165 Human papillomavirus infection     118896943   09171 Infectious disease: bacterial    05152 Tuberculosis     118896943   09163 Immune disease    05320 Autoimmune thyroid disease     118896943   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118896943   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     118896943  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bmus04052]     118896943 Cytokines and neuropeptides [BR:bmus04052]  Cytokines   Interferons    118896943 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  118896943 NCBI-ProteinID:  XP_036711486 UniProt:  A0A8B8XPT1 LinkDB All DBs Position 6:complement(45936607..45937176) Genome browser AA seq 189 aa AA seqDB search MAPTLSFLLALVLLSCNSTCSLGCDLPQTHSLASRRNLMLLQQMRRISPFSCLKDRKDFG FPQEAFGGNQFQKAQAIAVVHETIQQTFQLFSTEGSAAAWDETLLDKFCTALYQQLTDLQ ACVMQEAGLEGTPLLKEDSILAVRKYFHRITVYLQEKKYSPCAWEIVRAEVMRSFSSSTN LQERLRRKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccaaccttgtccttcctcctggccctggtgctgctcagctgcaactccacctgc tctctgggctgcgacctgcctcagacccacagcctggctagcaggaggaacctgatgctc ctgcaacaaatgaggagaatctcccccttctcctgcctgaaggacagaaaggactttgga ttcccccaggaggcgtttggtggcaaccagttccagaaggctcaagccatcgctgtcgtc catgagacgatccagcagaccttccagctcttcagcacggagggctcggctgccgcttgg gatgagaccctcctggacaagttctgcactgcactttatcagcagctcactgacctgcaa gcctgtgtgatgcaggaggcggggctggaagggactcccctgctgaaggaggactccatc ctggctgtgaggaaatacttccacagaatcactgtctatctgcaagagaagaaatacagc ccttgtgcctgggagattgtcagagcagaagtcatgagatccttctcttcatcaacaaac ttgcaagaaagactcaggaggaaggaatga

DBGET integrated database retrieval system