Balaenoptera musculus (blue whale): 118898230 Help Entry 118898230         CDS       T09887                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04022   cGMP-PKG signaling pathway bmus04081   Hormone signaling bmus04270   Vascular smooth muscle contraction bmus05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bmus00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     118898230 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     118898230 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     118898230 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     118898230 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bmus04052]     118898230 (NPPC) Cytokines and neuropeptides [BR:bmus04052]  Neuropeptides   Unclassified    118898230 (NPPC) SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  118898230 NCBI-ProteinID:  XP_036714215 UniProt:  A0A8C0C570 LinkDB All DBs Position 7 Genome browser AA seq 126 aa AA seqDB search MHLSQLLACALLLALLSLRPSEAKPGAPPKVPRTPPGEEVAEPQAAGGGQKKGDKTPGGG GANPKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcgcgctactctcgctccggccc tccgaagccaagcccggggcgccgccgaaggtcccgcgcactccgccaggggaggaggtg gccgagccccaggctgcgggcggaggtcagaagaagggcgacaagactcccgggggcggc ggcgccaatcccaagggcgaccggtcgcgactgctccgggacctgcgcgtggacaccaag tctcgggcggcgtgggcccgtcttctgcaagagcaccccaacgcgcgcaaatacaaggga ggcaacaagaagggtttgtccaagggctgcttcggcctcaagctggacaggatcggctcc atgagcggcctgggatgttag

DBGET integrated database retrieval system