Balaenoptera musculus (blue whale): 118899700 Help Entry 118899700         CDS       T09887                                  Symbol GSTP1 Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus00480   Glutathione metabolism bmus00980   Metabolism of xenobiotics by cytochrome P450 bmus00982   Drug metabolism - cytochrome P450 bmus00983   Drug metabolism - other enzymes bmus01100   Metabolic pathways bmus01524   Platinum drug resistance bmus05200   Pathways in cancer bmus05204   Chemical carcinogenesis - DNA adducts bmus05215   Prostate cancer bmus05225   Hepatocellular carcinoma bmus05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bmus00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     118899700 (GSTP1)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     118899700 (GSTP1)    00982 Drug metabolism - cytochrome P450     118899700 (GSTP1)    00983 Drug metabolism - other enzymes     118899700 (GSTP1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118899700 (GSTP1)    05204 Chemical carcinogenesis - DNA adducts     118899700 (GSTP1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     118899700 (GSTP1)    05215 Prostate cancer     118899700 (GSTP1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     118899700 (GSTP1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     118899700 (GSTP1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:bmus02000]     118899700 (GSTP1) Enzymes [BR:bmus01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      118899700 (GSTP1) Transporters [BR:bmus02000]  Other transporters   Pores ion channels [TC:1]    118899700 (GSTP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_C_2 GST_N_3 GST_N_2 Motif Other DBs NCBI-GeneID:  118899700 NCBI-ProteinID:  XP_036717481 UniProt:  A0A8B8Y6P5 LinkDB All DBs Position 8:104904111..104907005 Genome browser AA seq 210 aa AA seqDB search MPPYTIVYFPTRGRCEAMRMLLADQGQSWKEEVVTKESWLQGPLKASCLYGQLPKFQDGD LTLYQSNAILRHLGRSFGLYGKDQREAALVDMVNDGVEDLRRHCSHLIHHRHEEDKAQYV QELPGHLKPFETLLSQNQGGQAFIVGDQISFADYNLLDLLRSHQVLVPSCLDSFPLLSAY VARVSARPKLQAFLASPEHVNRPVFASRKI NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccctacaccatcgtctacttcccgacccgagggcgctgcgaggccatgcgcatg ctgctggccgaccagggccagagctggaaggaggaggtggtgaccaaggagtcctggttg cagggcccactcaaggcctcctgtctgtacgggcagctccccaagttccaggatggagac ctgaccctgtaccagtccaatgccatcctgcgacacctgggccgctcctttgggctctac ggcaaagaccagcgagaggcagcgctggtggacatggtgaacgacggtgtggaggacctc cgcaggcactgcagccacctcatccaccaccgccatgaggaggacaaggcccagtacgtt caggagctgccggggcacctgaagccttttgagaccctgctgtcccagaaccaagggggc caggccttcatcgtgggcgaccagatctccttcgcagactacaacctgctggacctgctg cggagtcaccaggtcctggtccccagctgcctggactccttccccctgctctcggcctac gtggcccgcgtcagtgcccggcccaagctccaggccttcctggcctccccggagcacgtg aaccgccccgtctttgcaagccgcaagatatga

DBGET integrated database retrieval system