Balaenoptera musculus (blue whale): 118899843 Help Entry 118899843         CDS       T09887                                  Name (RefSeq) histone H2AX   KO K11251   histone H2A Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus03082   ATP-dependent chromatin remodeling bmus04217   Necroptosis bmus04613   Neutrophil extracellular trap formation bmus05034   Alcoholism bmus05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bmus00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     118899843  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     118899843  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     118899843  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     118899843   09165 Substance dependence    05034 Alcoholism     118899843  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmus03036]     118899843   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bmus04147]     118899843 Chromosome and associated proteins [BR:bmus03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118899843 Exosome [BR:bmus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118899843 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  118899843 NCBI-ProteinID:  XP_036717730 UniProt:  A0A8B8YE62 LinkDB All DBs Position 8:13710588..13712137 Genome browser AA seq 143 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TSAAVGPKAPAGGKKATQASQEY NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgtcgggccgcggcaagacaggcggtaaggcccgcgccaaggccaagtcgcgctcgtcg cgagcgggcctccagttccccgtgggccgcgtgcaccggctgttgcggaagggacactac gccgagcgggtgggcgccggcgcgccggtctatctggcggcggtgctcgagtacctcaca gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcggatcatc ccccgccacctgcagctggccatccgtaacgacgaggagctcaacaagctgctgggcggc gtgacgatcgcccagggaggtgtcctgcccaacatccaggccgtactgctgcccaagaag accagcgccgccgtggggccgaaggcgcccgcgggcggcaagaaggccacccaggcctcg caggagtactga

DBGET integrated database retrieval system