KEGG   Balaenoptera musculus (blue whale): 118901791
Entry
118901791         CDS       T09887                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
bmus  Balaenoptera musculus (blue whale)
Pathway
bmus01521  EGFR tyrosine kinase inhibitor resistance
bmus01522  Endocrine resistance
bmus04010  MAPK signaling pathway
bmus04012  ErbB signaling pathway
bmus04014  Ras signaling pathway
bmus04015  Rap1 signaling pathway
bmus04062  Chemokine signaling pathway
bmus04068  FoxO signaling pathway
bmus04071  Sphingolipid signaling pathway
bmus04072  Phospholipase D signaling pathway
bmus04137  Mitophagy - animal
bmus04140  Autophagy - animal
bmus04150  mTOR signaling pathway
bmus04151  PI3K-Akt signaling pathway
bmus04210  Apoptosis
bmus04211  Longevity regulating pathway
bmus04213  Longevity regulating pathway - multiple species
bmus04218  Cellular senescence
bmus04360  Axon guidance
bmus04370  VEGF signaling pathway
bmus04371  Apelin signaling pathway
bmus04540  Gap junction
bmus04550  Signaling pathways regulating pluripotency of stem cells
bmus04625  C-type lectin receptor signaling pathway
bmus04650  Natural killer cell mediated cytotoxicity
bmus04660  T cell receptor signaling pathway
bmus04662  B cell receptor signaling pathway
bmus04664  Fc epsilon RI signaling pathway
bmus04714  Thermogenesis
bmus04720  Long-term potentiation
bmus04722  Neurotrophin signaling pathway
bmus04725  Cholinergic synapse
bmus04726  Serotonergic synapse
bmus04730  Long-term depression
bmus04810  Regulation of actin cytoskeleton
bmus04910  Insulin signaling pathway
bmus04912  GnRH signaling pathway
bmus04914  Progesterone-mediated oocyte maturation
bmus04915  Estrogen signaling pathway
bmus04916  Melanogenesis
bmus04917  Prolactin signaling pathway
bmus04919  Thyroid hormone signaling pathway
bmus04921  Oxytocin signaling pathway
bmus04926  Relaxin signaling pathway
bmus04929  GnRH secretion
bmus04933  AGE-RAGE signaling pathway in diabetic complications
bmus04935  Growth hormone synthesis, secretion and action
bmus04960  Aldosterone-regulated sodium reabsorption
bmus05010  Alzheimer disease
bmus05022  Pathways of neurodegeneration - multiple diseases
bmus05034  Alcoholism
bmus05160  Hepatitis C
bmus05161  Hepatitis B
bmus05163  Human cytomegalovirus infection
bmus05165  Human papillomavirus infection
bmus05166  Human T-cell leukemia virus 1 infection
bmus05167  Kaposi sarcoma-associated herpesvirus infection
bmus05170  Human immunodeficiency virus 1 infection
bmus05200  Pathways in cancer
bmus05203  Viral carcinogenesis
bmus05205  Proteoglycans in cancer
bmus05206  MicroRNAs in cancer
bmus05207  Chemical carcinogenesis - receptor activation
bmus05208  Chemical carcinogenesis - reactive oxygen species
bmus05210  Colorectal cancer
bmus05211  Renal cell carcinoma
bmus05212  Pancreatic cancer
bmus05213  Endometrial cancer
bmus05214  Glioma
bmus05215  Prostate cancer
bmus05216  Thyroid cancer
bmus05218  Melanoma
bmus05219  Bladder cancer
bmus05220  Chronic myeloid leukemia
bmus05221  Acute myeloid leukemia
bmus05223  Non-small cell lung cancer
bmus05224  Breast cancer
bmus05225  Hepatocellular carcinoma
bmus05226  Gastric cancer
bmus05230  Central carbon metabolism in cancer
bmus05231  Choline metabolism in cancer
bmus05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bmus05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bmus00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    118901791 (KRAS)
   04012 ErbB signaling pathway
    118901791 (KRAS)
   04014 Ras signaling pathway
    118901791 (KRAS)
   04015 Rap1 signaling pathway
    118901791 (KRAS)
   04370 VEGF signaling pathway
    118901791 (KRAS)
   04371 Apelin signaling pathway
    118901791 (KRAS)
   04068 FoxO signaling pathway
    118901791 (KRAS)
   04072 Phospholipase D signaling pathway
    118901791 (KRAS)
   04071 Sphingolipid signaling pathway
    118901791 (KRAS)
   04151 PI3K-Akt signaling pathway
    118901791 (KRAS)
   04150 mTOR signaling pathway
    118901791 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    118901791 (KRAS)
   04137 Mitophagy - animal
    118901791 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    118901791 (KRAS)
   04218 Cellular senescence
    118901791 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    118901791 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    118901791 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    118901791 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    118901791 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    118901791 (KRAS)
   04660 T cell receptor signaling pathway
    118901791 (KRAS)
   04662 B cell receptor signaling pathway
    118901791 (KRAS)
   04664 Fc epsilon RI signaling pathway
    118901791 (KRAS)
   04062 Chemokine signaling pathway
    118901791 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    118901791 (KRAS)
   04929 GnRH secretion
    118901791 (KRAS)
   04912 GnRH signaling pathway
    118901791 (KRAS)
   04915 Estrogen signaling pathway
    118901791 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    118901791 (KRAS)
   04917 Prolactin signaling pathway
    118901791 (KRAS)
   04921 Oxytocin signaling pathway
    118901791 (KRAS)
   04926 Relaxin signaling pathway
    118901791 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    118901791 (KRAS)
   04919 Thyroid hormone signaling pathway
    118901791 (KRAS)
   04916 Melanogenesis
    118901791 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    118901791 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    118901791 (KRAS)
   04726 Serotonergic synapse
    118901791 (KRAS)
   04720 Long-term potentiation
    118901791 (KRAS)
   04730 Long-term depression
    118901791 (KRAS)
   04722 Neurotrophin signaling pathway
    118901791 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    118901791 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    118901791 (KRAS)
   04213 Longevity regulating pathway - multiple species
    118901791 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    118901791 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118901791 (KRAS)
   05206 MicroRNAs in cancer
    118901791 (KRAS)
   05205 Proteoglycans in cancer
    118901791 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    118901791 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    118901791 (KRAS)
   05203 Viral carcinogenesis
    118901791 (KRAS)
   05230 Central carbon metabolism in cancer
    118901791 (KRAS)
   05231 Choline metabolism in cancer
    118901791 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    118901791 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    118901791 (KRAS)
   05212 Pancreatic cancer
    118901791 (KRAS)
   05225 Hepatocellular carcinoma
    118901791 (KRAS)
   05226 Gastric cancer
    118901791 (KRAS)
   05214 Glioma
    118901791 (KRAS)
   05216 Thyroid cancer
    118901791 (KRAS)
   05221 Acute myeloid leukemia
    118901791 (KRAS)
   05220 Chronic myeloid leukemia
    118901791 (KRAS)
   05218 Melanoma
    118901791 (KRAS)
   05211 Renal cell carcinoma
    118901791 (KRAS)
   05219 Bladder cancer
    118901791 (KRAS)
   05215 Prostate cancer
    118901791 (KRAS)
   05213 Endometrial cancer
    118901791 (KRAS)
   05224 Breast cancer
    118901791 (KRAS)
   05223 Non-small cell lung cancer
    118901791 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    118901791 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    118901791 (KRAS)
   05161 Hepatitis B
    118901791 (KRAS)
   05160 Hepatitis C
    118901791 (KRAS)
   05163 Human cytomegalovirus infection
    118901791 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    118901791 (KRAS)
   05165 Human papillomavirus infection
    118901791 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118901791 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    118901791 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    118901791 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118901791 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    118901791 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    118901791 (KRAS)
   01522 Endocrine resistance
    118901791 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bmus04131]
    118901791 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:bmus04031]
    118901791 (KRAS)
Membrane trafficking [BR:bmus04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    118901791 (KRAS)
GTP-binding proteins [BR:bmus04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    118901791 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin
Other DBs
NCBI-GeneID: 118901791
NCBI-ProteinID: XP_036721286
UniProt: A0A8C0D929
LinkDB
Position
10:complement(21040690..21080615)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggattcctac
agaaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata
aaaagagttaaagactctgaagatgtacctatggttctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatctgcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattgtaatgtaa

DBGET integrated database retrieval system