Balaenoptera musculus (blue whale): 118903067 Help Entry 118903067         CDS       T09887                                  Symbol GHRL Name (RefSeq) appetite-regulating hormone   KO K05254   ghrelin Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04024   cAMP signaling pathway bmus04080   Neuroactive ligand-receptor interaction bmus04081   Hormone signaling bmus04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:bmus00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     118903067 (GHRL)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     118903067 (GHRL)    04081 Hormone signaling     118903067 (GHRL)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     118903067 (GHRL)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bmus04052]     118903067 (GHRL) Cytokines and neuropeptides [BR:bmus04052]  Neuropeptides   GPCR binding    118903067 (GHRL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Motilin_assoc Motilin_ghrelin Motif Other DBs NCBI-GeneID:  118903067 NCBI-ProteinID:  XP_036723635 UniProt:  A0A8C0HXQ3 LinkDB All DBs Position 11:complement(97203381..97208046) Genome browser AA seq 117 aa AA seqDB search MPSPGTVCSLLLLSVLWVDLAMAGSSFLSPEHQKVQQRKESKKLSAKPKPRALEGWLDAE VRSQAEGAGDELEIQFSAPFDVGIKLSGAHSHQHGQTLGKFLQDVLWEDASETPADK NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgccctccccagggaccgtctgcagcctgctgctcctcagtgtgctctgggtggacttg gccatggcgggctccagcttcctgagccccgaacaccagaaagtgcagcagagaaaggaa tccaagaagctgtcagccaaaccgaagccccgggccctggaaggctggcttgacgcagaa gtcagaagtcaggcggaaggcgcaggggacgagctggaaatccagttcagcgcccccttt gacgttgggatcaagctgtcaggggctcactcccaccagcacggccagaccctggggaag tttcttcaggacgtcctttgggaagacgccagtgaaaccccagccgacaagtga

DBGET integrated database retrieval system