Balaenoptera musculus (blue whale): 118903434 Help Entry 118903434         CDS       T09887                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04137   Mitophagy - animal bmus04140   Autophagy - animal bmus04144   Endocytosis bmus04145   Phagosome bmus04148   Efferocytosis bmus05132   Salmonella infection bmus05146   Amoebiasis bmus05152   Tuberculosis Brite KEGG Orthology (KO) [BR:bmus00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118903434 (RAB7A)    04145 Phagosome     118903434 (RAB7A)    04140 Autophagy - animal     118903434 (RAB7A)    04137 Mitophagy - animal     118903434 (RAB7A)    04148 Efferocytosis     118903434 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118903434 (RAB7A)    05152 Tuberculosis     118903434 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     118903434 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bmus04131]     118903434 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bmus04147]     118903434 (RAB7A)    04031 GTP-binding proteins [BR:bmus04031]     118903434 (RAB7A) Membrane trafficking [BR:bmus04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     118903434 (RAB7A) Exosome [BR:bmus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118903434 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    118903434 (RAB7A)   Exosomal proteins of colorectal cancer cells    118903434 (RAB7A)   Exosomal proteins of bladder cancer cells    118903434 (RAB7A) GTP-binding proteins [BR:bmus04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     118903434 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 Septin PduV-EutP NTPase_1 AAA_7 AAA_22 AAA_16 AAA_24 AAA_5 G-alpha ATPase_2 NACHT NB-ARC AAA_14 SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  118903434 NCBI-ProteinID:  XP_036724442 UniProt:  A0A8B8YRG2 LinkDB All DBs Position 11:complement(102257216..102327961) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPESFPF VVLGNKVDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctcgaggaagaaagtgctgctgaaggtcatcatcctgggggactctggagtcggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagccaca ataggagcagactttctgacaaaggaggtgatggtggatgacagactagttacaatgcag atctgggacacggccgggcaggagaggttccagtctctgggtgtggccttctacagaggc gcggactgctgcgtcctggtgttcgacgtgactgcccccaacacgttcaagaccctcgac agctggagagacgagttcctcatccaggccagcccccgggaccctgagagcttccccttc gtcgtgctggggaacaaggttgacctcgagaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagcgccaaggaggccatc aacgtggagcaggccttccagacgattgcccggaacgcgctgaagcaggaaacggaggtg gagctgtacaatgaattccctgagcccatcaaactggacaagaacgaccgggccaaggcc tcggcggaaagctgcagctgctga

DBGET integrated database retrieval system