Balaenoptera musculus (blue whale): 118904000 Help Entry 118904000         CDS       T09887                                  Name (RefSeq) histone H2B type 1-L-like   KO K11252   histone H2B Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04613   Neutrophil extracellular trap formation bmus05034   Alcoholism bmus05203   Viral carcinogenesis bmus05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bmus00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     118904000  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     118904000   09163 Immune disease    05322 Systemic lupus erythematosus     118904000   09165 Substance dependence    05034 Alcoholism     118904000  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmus03036]     118904000   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bmus04147]     118904000 Chromosome and associated proteins [BR:bmus03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118904000 Exosome [BR:bmus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118904000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 Motif Other DBs NCBI-GeneID:  118904000 NCBI-ProteinID:  XP_036725522 UniProt:  A0A8B8YSQ6 LinkDB All DBs Position 11:20884079..20884467 Genome browser AA seq 126 aa AA seqDB search MPELAKSAPASKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagctggctaaatctgctcctgcttccaagaagggttctaagaaggcggtgacc aaggcgcagaagaaggatggtaagaagcgcaagcgcagccgcaaggagagctattccgtg tacgtgtacaaggtgctgaaacaggtgcacccggacactggtatttcgtccaaggccatg ggcatcatgaattcgttcgtcaatgacatctttgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaaacgctcgaccatcacctccagggagatccagacggccgtacgc cttctgctgcccggggaactggccaagcacgctgtgtccgagggtaccaaggctgtcacc aagtacaccagttccaagtaa

DBGET integrated database retrieval system