Balaenoptera musculus (blue whale): 118904006 Help Entry 118904006         CDS       T09887                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04613   Neutrophil extracellular trap formation bmus05034   Alcoholism bmus05203   Viral carcinogenesis bmus05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bmus00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     118904006  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     118904006   09163 Immune disease    05322 Systemic lupus erythematosus     118904006   09165 Substance dependence    05034 Alcoholism     118904006  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmus03036]     118904006 Chromosome and associated proteins [BR:bmus03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118904006 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  118904006 NCBI-ProteinID:  XP_036725528 UniProt:  A0A8B8YSR1 LinkDB All DBs Position 11:complement(20900210..20900600) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgaggcaaaggtggtaagggattggggaagggcggcgctaagcgccatcgt aaggttttgcgtgacaatatccagggtatcaccaagcccgccatccggcgtctggcccgg cgaggtggggtcaagcgcatatctggtctgatttatgaagagacccgcggggtactgaag gtgtttttggagaacgtgatccgggacgcggtcacttacacggagcacgccaagcggaag accgtcaccgccatggacgtagtgtacgccctcaaacgccagggacgcaccctctacggc ttcggcggttag

DBGET integrated database retrieval system